KEGG   Serratia plymuthica 4Rx13: SOD_c20260Help
Entry
SOD_c20260        CDS       T02710                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SOD_c20260 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGO55000
UniProt: S0AGW0
LinkDB All DBs
Position
2201854..2202378
Genome map
AA seq 174 aa AA seqDB search
MKHYWYAAFGLMACGVAQAAAVDVDMNLVTGQGIGQEIGKVTISETPYGLLFTPQLKALP
AGVHGFHVHENGSCEPGMKEGKAVAALAAGGHFDPQKTGKHLGPYADGHLGDLPAIYVTA
DGMSTDPVLAPRLKKISEITGKALMVHAGGDNHSDHPKPLGGGGERFACGVIKG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattggtatgcggccttcggcctgatggcctgtggcgtcgcccaggcggca
gcggtggatgttgacatgaatctggtgaccggacagggaattggccaggagattggcaaa
gtcacgatcagcgaaacgccttacggcctgctgtttacccctcagttaaaagcgttgccg
gccggagtgcacggctttcacgtgcatgagaacggcagttgcgagccgggaatgaaagag
ggtaaggcggtagcggcgctggcggcgggtgggcattttgatccgcaaaaaaccggcaag
caccttggcccttacgcagacggccatttgggcgatctgccggccatttacgttacggca
gacggcatgtccacggatccggtgctggcgccacgtctgaaaaaaatcagcgaaatcacc
ggcaaagcgctcatggtacatgccggcggcgacaaccactccgatcatccgaaacccttg
ggtggcggaggggaacgttttgcctgcggtgtgattaaagggtaa

DBGET integrated database retrieval system