KEGG   Salinibacter ruber M8: SRM_02657Help
Entry
SRM_02657         CDS       T01209                                 

Gene name
glpA
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srm  Salinibacter ruber M8
Pathway
srm00564  Glycerophospholipid metabolism
srm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SRM_02657 (glpA)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SRM_02657 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8 ApbA FAD_oxidored Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: CBH25578
UniProt: D5HC23
LinkDB All DBs
Position
complement(3118258..3119544)
Genome map
AA seq 428 aa AA seqDB search
MSNFCAHRTLPQFLHGPPPNMNDSPAVLVIGGGATGTGIARDLALRGVEVLLVEREGLSS
GASSRSHGLLHSGARYAEANRVGAEECIVENRVLRSIAGACIRDTGGLFVQLADDDPDYF
EEKRAACDAIGIETTLLSAAEAQARVPGLSDEVERAMWVPDGVVYPSRLSAANAADAEAH
GGFVRPHAPLEDLVVERGQVVKALIGGTVDAAVEPTYVVNATGAWAGTIASMADVDLGMA
PSRGVMISVEYEGLGPALNRCRDPDDGDIVVPHDDEVVLGTTSVPVSDPDDYEEADWEVE
TSVRECATMLPPVADAPTVRTWWGVRPLYAPDEQASNRRGISRGFTTVDHAADGVGNFAS
IVGGKLTTYRQMAEAVSDHVCGELGVDAACETATRPLPGADDPDRLDEFVAAYDGQGPTD
ADVSGRRE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaacttttgtgcccatcggacacttccccaatttctccacggacccccgcccaac
atgaacgactcccccgcagtactcgtgattggcggcggcgccaccggcacgggcatcgcc
cgggacctcgcgctgcgcggcgtcgaggtgcttctggtagagcgggaggggctctccagc
ggggcctccagtcgctcccacggactgctacacagcggggcccgttacgccgaggccaac
cgggtgggggcggaggagtgcattgtggagaaccgcgtcctccggtccatcgccggggcg
tgcatccgggacaccggcggcctgttcgtccagctggccgacgacgacccggactacttc
gaggagaaacgggcggcctgcgacgcgattgggatcgagacgaccctgctcagcgcggcg
gaggcccaggcccgcgtgccgggcctgtcggacgaggtggagcgggccatgtgggtgccc
gacggggtggtgtacccgtcgcgcctcagtgccgccaatgccgccgatgccgaggcccat
ggcgggttcgtgcgtccccacgcgccccttgaggacctggtggttgagaggggacaggtc
gtgaaggcactgatcggtgggacggtcgacgcggcggtcgagccgacatacgtcgtgaac
gcgacgggggcctgggcgggcacgattgcgtcaatggccgatgtcgacctgggaatggcc
ccctcccggggcgtcatgatctcggtggagtacgagggcctcggcccggcgctgaaccgg
tgtcgcgacccggacgacggggacatcgtcgtgccccacgacgacgaggtggtgctggga
accacgagcgtgccggtgtcggacccggacgactacgaggaggccgactgggaggtcgag
acgtccgtccgggagtgcgccaccatgctgccccctgtggccgacgccccgacggtccgc
acgtggtggggcgtgcggccgctgtacgcccccgacgagcaggcgagcaatcggcgcggc
atctcgcggggctttaccaccgtggaccacgccgccgacggggtgggcaactttgccagt
attgtcggcggcaagctgacgacctaccgacagatggcggaggccgtgtccgatcacgtc
tgcggcgagctcggcgtggacgccgcgtgcgagacggcgacccggccgctgcccggcgcc
gacgatcccgaccggctcgacgaattcgtcgcggcctacgacggacaggggccgaccgac
gcggacgtgtccggacggagggaatag

DBGET integrated database retrieval system