KEGG   Streptomyces rubrolavendulae: A4G23_02956Help
Entry
A4G23_02956       CDS       T04616                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
srn  Streptomyces rubrolavendulae
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srn00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    A4G23_02956 (kynU)
Enzymes [BR:srn01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A4G23_02956 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3444956..3446380
Genome map
AA seq 474 aa AA seqDB search
MSELLHDETEGAGTGRGGTAAGAGADAETRVPGAAATEGVPATEGAPAAGDGGLAARAAA
LDAADPLAKRRELFALDDGAVYLDGNSLGALPRHVPARMAHVIAHEWGELRIRSWGESGW
WTAPERIGDRIAPLVGAAPGQVVVGDSTSVNVLKALVGAVRLADAYAGEGRDGGGPVRDE
ILVDATTFPTDGYIAESAARMTGRRLVPVAPGDVPDAVGPRTAAVLVNHVDYRTGRLHDL
PGVTAAVRDAGALAVWDLCHSAGALPVDLDANGVDLAVGCTYKYLNGGPGAPAFLYVAER
HQARFDSPLPGWNSHADPFAMTPGYAAVDGARRGRVGTPDILSMLALESALDVWDGVAVG
EVRAKSLALTDFFLECVRAYVPEGRLTCLTPAAHAERGSQVALSCPDAPAVMERLIERGV
VGDLRRPDVLRFGFTPLYVGYADAERAARVLAEVCAEVAAEGSTEGSTEVSAAR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctcctgcacgacgagaccgagggcgccgggaccgggcgcggcgggactgcc
gcgggcgcgggcgcggacgccgagacccgggtgcccggcgcggcggccaccgaaggcgta
ccggccaccgaaggcgcaccggccgccggggacggcgggctcgcggcgcgggccgccgcc
ctggacgccgccgacccgctggcgaagcggcgcgagctgttcgccctcgacgacggcgcc
gtctacctcgacggcaactcgctcggcgccctgccccgccacgtacccgcccggatggcg
cacgtcatcgcccacgagtggggcgagctgcgcatccgctcgtggggcgagagcggctgg
tggacggcgccggagcggatcggcgaccggatcgccccgctggtcggcgcggcgcccggc
caggtcgtggtcggcgactcgaccagcgtcaacgtcctcaaggcgctggtcggagcggtc
cgcctggcggacgcgtacgccggcgagggccgggacgggggcgggcccgtccgggacgag
atcctggtggacgcgacgacgttccccacggacggctacatcgccgagtccgccgcccgg
atgaccggccgccgcctggtgccggtcgcgcccggagacgtaccggacgccgtcggcccg
cgcacggccgccgtactcgtcaaccacgtcgactaccgcaccggccgcctccacgacctg
cccggcgtcaccgccgccgtgcgggacgcgggcgccctcgcggtgtgggacctgtgccac
agcgcgggcgcactccccgtcgacctggacgcgaacggcgtcgacctggccgtcggctgc
acgtacaagtacctgaacggcgggcccggcgcccccgcgttcctgtacgtcgccgaacgc
caccaggcgcgcttcgactcgccgctgcccggctggaactcgcacgcggacccgttcgcg
atgacgcccggctacgcggcggtggacggggcgcggcgcggtcgcgtcggtacgcccgac
atcctgtcgatgctggccctggagtcggctctcgacgtgtgggacggcgtcgcggtgggc
gaggtgcgggccaagagcctcgcgctgacggacttcttcctggagtgcgtccgcgcgtac
gtccccgaggggcggctcacctgcctcaccccggccgcgcacgcggagcgcggcagccag
gtcgcgctctcctgcccggacgcgcccgccgtcatggaacggctcatcgagcggggcgtg
gtcggcgacctgcgccgccccgacgtgctgcggttcggcttcacgccgctgtacgtcggg
tacgccgacgccgagcgcgccgcgcgcgtgctggccgaggtgtgcgctgaggtcgcggcg
gagggctccacggagggctccacggaggtctccgcagcgcggtag

DBGET integrated database retrieval system