KEGG   Streptomyces rubrolavendulae: A4G23_04881Help
Entry
A4G23_04881       CDS       T04616                                 

Gene name
argD_2
Definition
(GenBank) Acetylornithine aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srn  Streptomyces rubrolavendulae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A4G23_04881 (argD_2)
   00650 Butanoate metabolism
    A4G23_04881 (argD_2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4G23_04881 (argD_2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4G23_04881 (argD_2)
Enzymes [BR:srn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A4G23_04881 (argD_2)
Amino acid related enzymes [BR:srn01007]
 Aminotransferase (transaminase)
  Class III
   A4G23_04881 (argD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5774348..5775658
Genome map
AA seq 436 aa AA seqDB search
MTGQHHLHAHRHLHDRHRAVLPDWLSLYYDEPIEITHGEGRHVWDAEGNRYLDFFGGILT
TMTAHALPEVTKAVTEQAGRVIHTSTLYLDRPMVDLAERIAALSGIRDARVFFTTSGTEA
NDTALLLATAYRRSNQVLAMRNSYHGRSFSAVSVTGNRSWTTTGLSGLHTLYVHGAVRRR
GPFAHLPDAEFTAACVADLEDLIGHTGDVAALIAEPIQGVGGFTSPPDGLYAAFREVLDR
HGILWISDEVQTGWGRTGDHFWGWQAHAASGPPDILTFAKGIGNGMSVGGVVARAEVMNC
LTANSISTFGGSPVTMAAALANLSYLLEHDLQGNARRVGGLLAERLRAVAAGVDRVREVR
GRGLMIGVELADPATGAADPDAAAAVLEAARAEGLLIGKGGGHDTSVLRVAPPLSLTVAE
AEEGAALLERALRVLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggacagcaccatctccacgcccaccgccacctccacgaccgccaccgcgccgtc
ctgcccgactggctctccctctactacgacgagcccatcgagatcacccacggcgagggc
cgccacgtgtgggacgccgagggcaaccggtacctggacttcttcggcggcatcctcacc
accatgaccgcccacgccctccccgaggtcaccaaggccgtcaccgagcaggccgggcgc
gtcatccacacctcgacgctctacctcgaccgccccatggtcgacctggccgagcggatc
gccgcgctctccggcatccgcgacgcgcgggtcttcttcaccacctccggcaccgaggcc
aacgacacggcgctcctgctcgccaccgcctaccgccgcagcaaccaggtcctggcgatg
cgcaacagctaccacggccggtccttctccgccgtctccgtcaccggcaaccgctcctgg
accaccacgggcctgtccggtctgcacacgctgtacgtccacggggccgtgcgccgccgg
gggcccttcgcgcacctgcccgacgccgagttcaccgccgcgtgcgtcgccgacctggag
gacctgatcggccacaccggggacgtcgccgcactgatcgccgagccgatccagggcgtc
ggcggcttcacctccccgccggacgggctgtacgcggcgttccgcgaggtcctcgaccgg
cacggcatcctgtggatcagcgacgaggtgcagaccggctggggccgtaccggcgaccac
ttctggggctggcaggcgcacgccgcgagcgggccgccggacatcctgaccttcgccaag
ggcatcggcaacggcatgtccgtcggcggggtcgtcgcccgcgccgaggtgatgaactgc
ctgacggccaactccatctccaccttcggcggctccccggtcaccatggccgccgcgctc
gccaacctctcgtacctcctcgagcacgacctccagggcaacgcccggcgcgtcggcggc
ctcctcgccgaacggctccgcgccgtcgcggcgggggtcgaccgggtacgggaggtgcgc
ggacgcggtctgatgatcggcgtcgagctggccgacccggcgaccggcgcggccgacccg
gacgccgcagccgccgtactggaggcggcccgcgcggaagggctgctgatcggcaagggc
ggcggccacgacaccagcgtcctgcgcgtcgccccgccgctctcgctcaccgtcgccgag
gccgaggagggcgccgccctcctggaacgggccctgcgcgtcctgcggtag

DBGET integrated database retrieval system