KEGG   Streptomyces rubrolavendulae: A4G23_05108Help
Entry
A4G23_05108       CDS       T04616                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
srn  Streptomyces rubrolavendulae
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:srn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4G23_05108 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A4G23_05108 (icd)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A4G23_05108 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6020289..6022508)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASAAGVSVETRDISLAGRIIASFPEYLQEGQ
RIDDALAELGELAKTPGANIIKLPNISASIPQLKAAVAELQEQGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGADD
FRSTEKSAVVAEDGSLRIELAGEDGSTTVLRESVPVLAGEVVDASVMRAEALRAFLSEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAAYGDVLAGAGLSPNDGLGGI
LKGLDSLPQGEEIKASFDAELAEGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGKEADTLAVLPDSSYSGVYQAVIEDCRAHGALDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIAQPGTVRVVDQAGEVVLEQPVGRGDIFRMCQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDARLIEKVKAYLPEHDTEGLRIEIMPPVEATKFSLERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLSQVTGNARAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LALYWAQELARQTDDAALAEAFGPLAKTLTEQEGAIVEELNAVQGEPADIGGYYQPDPEK
AAAVMRPSRTFNQALGTLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacccacactgacgaggccccggccctggcgacgtac
tcgttcctgcccgtggtccaggcgtacgcctcggcggccggcgtcagcgtcgagacccgc
gacatctcgctggccgggcggatcatcgcctccttcccggagtacctccaggaggggcag
cgcatcgacgacgccctcgccgagctgggcgagctggcgaagacgcccggcgccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctgaaggccgccgtcgcggagctg
caggagcagggctacgcgctgccggactacccggacgacccgaagacggacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactcggaccgccgcgcccccgcgtcggtcaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggacggccgactccaagacgaacgtggcgacgatgggcgccgacgac
ttccggtccaccgagaagtcggcggtcgtcgccgaggacggctcgctgcgcatcgagctg
gccggcgaggacggctcgacgaccgtgctgcgcgagtccgtgcccgtgctggcgggcgag
gtcgtggacgcgtcggtgatgcgcgccgaggcgctgcgcgccttcctctccgagcaggtc
gcccgcgccaaggccgagggcgtgctgttctccgtccacctgaaggcgacgatgatgaag
gtctcggacccgatcatcttcggccacgtggtccgcgcgttcttcccgaagaccttcgcc
gcctacggcgacgtgctggccggcgccggcctgagcccgaacgacggcctcggcggcatc
ctgaagggcctggactccctgccgcagggcgaggagatcaaggcgtccttcgacgccgag
ctggccgagggcccggccctggccatggtcgactccgaccgcggcatcaccaacctgcac
gtaccgagcgacgtcatcgtcgacgcgtcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggcaaggaggccgacaccctcgcggtcctgcccgacagcagctac
tccggcgtgtaccaggccgtcatcgaggactgccgcgcccacggcgccctcgacccggcg
accatgggctccgtgccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgcgcagcccggcaccgtccgcgtggtcgaccaggccggc
gaggtcgtcctggagcagccggtcggccgcggcgacatcttccgcatgtgccagacgaag
gacgccccgatcagggactgggtgaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgcccggctcatcgagaaggtc
aaggcgtacctgccggagcacgacaccgagggcctccggatcgagatcatgccgccggtc
gaggcgacgaagttctccctggagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctcggcaccagc
gccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctcttcgagacgggtgcg
ggcggctccgccccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctcggcgagttcctcgcgctggcggtcagcttcgagcacctctcgcaggtcacgggc
aacgcccgtgccaaggtcctcgcggacaccctggaccgcgccacggccaccttcctcaac
gaggacaagtcgccgacccgccgcgtcggcggcatcgacaaccgcggcagccacttctac
ctcgccctgtactgggcgcaggagctggcgcggcagacggacgacgccgcgctcgccgag
gcgttcgggccgctcgcgaagaccctcaccgagcaggagggcgcgatcgtcgaggagctg
aacgcggtgcagggcgagccggccgacatcggcggctactaccagcccgacccggagaag
gcggcggcggtcatgcgcccgtcccgcaccttcaaccaggcgctggggaccctggcctga

DBGET integrated database retrieval system