KEGG   Streptomyces rubrolavendulae: A4G23_05442Help
Entry
A4G23_05442       CDS       T04616                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn03030  DNA replication
srn03410  Base excision repair
srn03420  Nucleotide excision repair
srn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:srn00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A4G23_05442
   03410 Base excision repair
    A4G23_05442
   03420 Nucleotide excision repair
    A4G23_05442
   03430 Mismatch repair
    A4G23_05442
Enzymes [BR:srn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A4G23_05442
    6.5.1.6  DNA ligase (ATP or NAD+)
     A4G23_05442
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     A4G23_05442
DNA replication proteins [BR:srn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    A4G23_05442
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     A4G23_05442
DNA repair and recombination proteins [BR:srn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     A4G23_05442
   NER (nucleotide excision repair)
    Other NER factors
     A4G23_05442
   MMR (mismatch exicision repair)
    Other MMR factors
     A4G23_05442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: AOT62544
UniProt: A0A1D8GAS4
LinkDB All DBs
Position
6438428..6439984
Genome map
AA seq 518 aa AA seqDB search
MGRMLLARLADVSEQVAATSARSRKIAVLADLFAATPPAEVPLVIAYLAGRLPQGRIGIG
WSTLKDPVAPAGHATLTVAGTDAALTALAGVAGAGSRTERRRLVRDLMAAATAPEQRFLV
RLLAGEVRQGALDAIALEGVAQAAGAPPADVRRAVMLDGSLPRVATVLLAEGPAVLERFR
LAVGTPVQPMLAHTAKSVADALAALGPCAVEEKLDGIRIQVHRSGDDVRIYTRSLDEITD
RLPEVRGVARDVAGDAFILDGEVIALDGAGRPVPFQETASRVGSRVDVATAAAARPVSPV
FFDLLALDGRALLDLPGHERHAELARLVPDPLRVRRTVVTDPADPGQRRAAEAFFAGTLD
RGHEGVLVKALDAPYSAGRRGRSWLKVKPVHTLDLVVLAAEWGHGRRTGLLSNLHLGARA
ADGTFVMLGKTFKGLTDEMLRWQTDRLRELAVSDDGSTVTVRPELLVEIAYDGLQRSPRY
PAGVTLRFARVVRHRPDKPAAQADTVERVVAGPQSRVV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcatgctgctggcccgactcgccgacgtctccgagcaggtcgccgccacctcg
gcgcgctcccgcaagatcgccgtgctggccgacctgttcgccgcgaccccgcccgccgag
gtccccctcgtcatcgcctacctcgcgggccgtcttccgcaagggcgcatcggcatcggc
tggtccaccctcaaggaccccgtcgcgcccgccggacacgcgaccctcaccgtcgccggc
acggacgccgcgctcaccgcgctcgccggtgtcgcgggcgcgggctcccgtacggagcgc
cgccggctcgtccgcgacctgatggccgccgccaccgcccccgagcagcggttcctggtc
cggctgctcgcgggggaggtgcggcagggcgccctcgacgccatcgccctggaaggtgtc
gcccaggcggccggggcaccgcccgccgacgtgcgccgcgcggtcatgctcgacggctcg
ctgcccagggtcgccaccgtgctgctcgccgagggcccggccgtactggagaggttccgc
ctcgccgtcggcacccccgtccagccgatgctggcccacaccgcgaagagcgtcgcggac
gcgctcgccgcgctcgggccgtgcgccgtggaggagaagctcgacggcatccgcatccag
gtccaccgctcgggcgacgacgtgcggatctacacccggtccctggacgagatcaccgac
cggctccccgaggtccgcggcgtcgcgcgggacgtggcgggcgacgcgttcatcctcgac
ggcgaggtgatcgccctggacggggccggccgccccgtacccttccaggagaccgcctcc
cgcgtgggctcacgcgtcgacgtggccaccgccgcggcggcccgcccggtgtcccccgtc
ttcttcgacctcctcgccctcgacgggagagccctgctcgacctgcccggacacgagcgg
cacgcggaactcgcgcgcctcgtgcccgaccccctgcgggtgaggcggaccgtcgtcacc
gaccccgccgaccccgggcagcgccgggcggccgaggcgttcttcgccggcaccctcgac
cgggggcacgagggtgtgctcgtcaaggcgctcgacgcgccctacagcgccgggcggcgc
ggccgctcgtggctgaaggtgaagccggtccacaccctcgacctcgtggtcctggcggcc
gagtggggccacgggcggcgcaccggactgctgtccaacctgcacctgggcgcccgcgcc
gccgacgggacgttcgtgatgctgggcaagacgttcaagggcctgacggacgagatgctg
cgctggcagaccgaccggctgcgcgagctcgccgtctcggacgacggctccaccgtcacc
gtacgacccgaactgctcgtcgagatcgcgtacgacggactgcagcgctccccgcgctac
ccggccggggtgacgctgcgcttcgcccgcgtcgtacggcaccgcccggacaagcccgcc
gcccaggccgacaccgtcgagcgggtcgtggccggccctcagtcacgcgtggtgtag

DBGET integrated database retrieval system