KEGG   Streptosporangium roseum: Sros_1947Help
Entry
Sros_1947         CDS       T01137                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sro  Streptosporangium roseum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sros_1947
   00650 Butanoate metabolism
    Sros_1947
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sros_1947
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sros_1947
Enzymes [BR:sro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sros_1947
Amino acid related enzymes [BR:sro01007]
 Aminotransferase (transaminase)
  Class III
   Sros_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2087063..2088364
Genome map
AA seq 433 aa AA seqDB search
MSDLLARHRAVMPNWLALYYNEPIEIVGGKGNRVVDASGKSYLDFFAGILTNMIGYDVPE
VREAVERQLATGVVHTSTVYLLRGQVELAEKIAKLSGIKDAKVFFTNSGTEANETALLLA
TYARKSDQVLAMRQSYHGRSFGAVSVTSNRAWKNNSLSPLNVHFLHGADRHLTQFRGLSD
ADYIKACVDDLRHVLSTSVSDDVAALIAEPIQGVGGFTMAPDGLFAAYKEVLDEQGILFV
SDEVQTGWGRTGSAFFGIQNHGVTPDMMTFAKGLGNGFAVGGVVARGDLMDNLHAVGLAT
FGGNPISMAAANATLDYVLDHDLQANAARTGALIIDGLREAAPRLPIVGDVRGKGLMFAV
ELVDPATGEPSPALAARFMEETKKAGLLAGKGGLYGNVLRMAPPLTLTPDEAAEGLGIIV
NALEVINAEVVPS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccttctcgcacgccaccgggcggtaatgcccaactggctggccctctattac
aacgagcccatcgagatcgtcggcggcaagggcaaccgggtcgtcgacgcgtcggggaag
agctatctggacttcttcgcgggcatcctgaccaacatgatcgggtacgacgtgcccgag
gtgcgcgaggccgtcgagcgccagctcgccaccggggtcgtccacacctccacggtctac
ctgctccgaggccaggtcgagctcgccgagaagatcgccaagctgtccggtatcaaggac
gcgaaggtcttcttcaccaactccggcaccgaggccaacgagaccgcgctgctgctggcg
acctacgcgcgcaagtccgaccaggtgctcgccatgcggcagagctaccacggccgctcc
ttcggcgcggtcagcgtgaccagcaaccgcgcatggaagaacaactcgctgtcgccgctg
aacgtgcacttcctgcacggcgccgaccggcacctcacgcagttccgcgggctgtcggac
gccgactacatcaaggcgtgcgtcgacgacctgcgccacgtgctctccacgtccgtctcc
gacgacgtggccgcgctcatcgccgagccgatccagggtgtcggcgggttcaccatggcc
cccgacgggctgttcgccgcctacaaggaggtcctggacgagcagggcatcctgttcgtc
tccgacgaggtgcagaccggctggggccgtaccggctcggccttcttcggcatccagaac
cacggcgtcacgccggacatgatgaccttcgccaaggggctgggcaacggcttcgcggtc
ggcggcgtcgtggcccgcggcgacctgatggacaacctgcacgcggtcggtctcgcgacc
ttcggcggcaacccgatctcgatggccgccgccaacgcgacgctggactacgtcctcgac
cacgacctgcaggcgaacgccgcccggaccggtgccctgatcatcgacgggctccgcgag
gccgcgccgcgcctgccgatcgtcggcgacgtccgcgggaagggcctgatgttcgccgtc
gagctcgtcgacccggcgaccggcgagccctccccggcactcgcggcccggttcatggag
gagaccaagaaggccggtctgctcgcgggcaagggcggcctgtacggcaacgtgctccgc
atggccccgccgctcaccctgacgccggacgaggccgccgagggcctcgggatcatcgtc
aacgcactcgaagtcatcaacgccgaggtggtcccgtcgtga

DBGET integrated database retrieval system