KEGG   Streptococcus suis ST1: SSUST1_0607Help
Entry
SSUST1_0607       CDS       T02125                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srp  Streptococcus suis ST1
Pathway
srp00473  D-Alanine metabolism
srp00550  Peptidoglycan biosynthesis
srp01100  Metabolic pathways
srp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSUST1_0607 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUST1_0607 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SSUST1_0607 (ddlA)
Enzymes [BR:srp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSUST1_0607 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:srp01011]
 Precursor biosynthesis
  Amino acid ligase
   SSUST1_0607 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AER20998
UniProt: G7SLV6
LinkDB All DBs
Position
617236..618282
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFISQTGDFIKTQEFSQTPS
ADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIEGKLTYPVFVKPANMGSSV
GISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLGNADVKTTLPGEVVKDVAF
YDYDAKYIDNKITMEIPAKIDESIMDIMRDNAAKAFRAIGGCGLSRCDFFLTEDGDIFLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIEELVRLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatct
gttctgtctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacc
tatttcattagccagaccggggactttattaagacgcaagagttttctcaaacaccgtct
gccgatgaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagc
gatatttatgaagaaaaggcggttgttttccctgttcttcatggcccaatgggagaagac
ggatctattcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttg
tcttcaagcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatc
tcccaggtaccttatgtggcagttatcgagggtgaaaatatcgacgataagattgcagag
attgaaggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtc
ggtatctcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaag
tatgatagccgtgtcctcgttgagcagggtgttaatgcgcgtgagattgaggtcggtctt
ttgggaaatgctgacgtgaaaacgacacttcctggcgaagtagtcaaagacgttgctttt
tatgactacgatgccaaatacatcgacaacaaaatcaccatggaaatcccagctaagatt
gatgagtctatcatggatatcatgcgtgataatgctgccaaggccttccgtgctatcggt
ggttgtggactttctcgctgtgatttcttcctgactgaagacggcgacatcttcctaaac
gaactcaataccatgccaggtttcacccaatggtctatgtatccactcctttgggataat
atgggcctagcttatccagacttgattgaagagcttgttcgtttggctaaggaaatgttt
gaaaaacgcgaaagtcacctcatttaa

DBGET integrated database retrieval system