KEGG   Serratia sp. AS12: SerAS12_4735Help
Entry
SerAS12_4735      CDS       T01502                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srs  Serratia sp. AS12
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SerAS12_4735
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SerAS12_4735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
5106341..5107849
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPDLKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYHGDPKDVKIDDNEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIGGDRDSYAAKLRREHGWLPESLARRYART
YGSHSELILANANGLSSLGEEFGHGLYEAELRYLVEKEWVVELEDAIWRRTKLGMWLDDA
QQARVKAWLAQHTKTKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgcgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgcctggtgagcgaagcgctggccgagcgtgaagtgttgctgaagctggcgccgcac
atcgcgttccccatgcgtttccgcctgccgcaccagccgcatctgcgcccggcctggatg
atccgcatcggcctgttcctgtacgatcacctgggcaaacgcaccagcctgccgggcagc
aagagtttgcgatttggaccagaatcggtacttaagcctgatctgaagcgcggtttcgaa
tattccgactgctgggtggatgatgcccgcctggtggtgctgaacgcacaggaagtggaa
aaacgcggcggtgaagtacgcacccgcaccaaagtgacccgtgcatggcgtgaaaacggc
ctgtggatggtggaagcggttgacgtcgacagcggtaaaacctttacctggcgcgccaag
ggcctggtcaacgccaccggcccttgggtgaaacacttcttcgacgacggcctgaagctg
aaatccccgtacggcatccgcctgatcaaaggcagccatatcgtggtgccacgtgctcac
aaccagccgcagtcctatattctgcaaaacgaagaccaccgcatcgtattcgtgatcccg
tggaatgacgaattctcgatcatcggcaccaccgacgtggaataccacggcgatccgaaa
gacgtgaagatcgacgataacgagatcgactacctgctgaaagtgtacaacgaccacttc
aagaagcagttgggccgtgacgacatcgtctggacctactccggtgtgcgtccgctgtgc
gatgacgaatccgattcgccgcaggcggtgacccgcgactacacgctggacgtgcatgac
gagcagggcaaagcgccgctgctgtcggtgttcggcggtaaactgaccacctatcgcaag
ctggctgaacatgcgatggaaaaactggcgcattactaccctggctgcggcccggcgtgg
accaaaaacggttcgctgcccggcggcgacatcggtggcgatcgcgacagctatgccgcc
aaactgcgccgcgaacacggctggttgccggaatccctggcgcgccgctacgcccgcacc
tacggcagccacagcgagctgatcctggcgaatgccaacggcctcagcagcctgggcgaa
gagtttggtcacggcctgtatgaagccgaactgcgctatctggtagagaaagagtgggtg
gtcgagctggaagacgccatctggcgccgcaccaagctgggtatgtggctggatgatgcg
cagcaggcgcgggtgaaagcctggctggcgcaacacacgaaaacgaaaacgctctctctg
gcttcctga

DBGET integrated database retrieval system