KEGG   Segniliparus rotundus: Srot_1351Help
Entry
Srot_1351         CDS       T01238                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
srt  Segniliparus rotundus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1341648..1343366
Genome map
AA seq 572 aa AA seqDB search
MTGTGEDVVPRHPSVLHALRSHALGGTQRTITVLGRSTAALGVSELAAAAQRYAAVLSGL
GVRAGDRVLLGMPTRLESLIGFFAVQLLGAVPAPVAVPAGARREAAERTLADLSRYLRPA
AIVAPQAVAAELAQRRGSLGELVVDGEAVFRRASEPGASLHEFRLPRPSEPAFIQCTSGS
TGNPKGVVVSHANIASNCEQIAEFARWGVDDVWVGWLPLYHDMGLIGGLLTPLFVGSSAV
FLPPARFLRSPAQWLRAIGEYRGSISATPNFGLAYAAARIGEAELDAVDVSSMRRIFCGA
EPVGRRDVEAFTERFARHGLPADAVVPCYGLAEATLIVTAASPSESLRADIVSRRALAAQ
GRAVPAVQGDPDAQEVVEVGQAVRGTEIRVVDEADGPVADGVLGLVQFRGPSRTDGYYEL
PEATADCLRPGGWWNTGDIGYMRRGSLRITGRQRDLIVIRGANYFPDDFERAAQSVDGVV
PGAVVATGDHDAACGTEQLCLIVEVAAEAGSYRELDRSIRAAVSAQTGVAVSRVVFVPRH
SIPKTTSGKVRRALARQRFVVEAGPGDVAALG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgacggggacgggcgaggatgtcgtgcctcggcatccgagcgtgctgcacgcgttgcgc
agccatgcgctgggggggacacagcggacgataaccgtgctgggccgcagcactgcggcg
ctgggagtgtccgagctcgcggcagcagcccagcggtatgcggcagtgctctccggcctc
ggcgtgcgggcaggggaccgggtgctgttggggatgccgacccgactggagtcgttgatc
ggatttttcgccgtccagctgctcggcgccgtgccggcgccggtggcggtgcccgctggc
gcgcgaagggaagcggccgagcggaccctcgcggatctgtcgcggtatttgcggcctgcg
gcgattgtggcgccgcaggcggtggcggccgagctcgcgcagcgacgcggctcgctgggc
gagctcgtggtggacggcgaagccgtgttccggcgcgcaagcgagccgggagcctcgctg
cacgagttccggctcccgagaccgagtgaacccgcgttcatccagtgcacatctggatcg
accggcaaccccaagggggtggttgtctcgcacgcgaacatcgcgtccaactgcgagcag
atagcggagttcgcccgctggggcgttgacgacgtctgggtcggctggcttcccctctac
catgacatggggttgatcggcggactgttgacgccgttgttcgtcgggagcagcgccgtt
ttcttgcccccggctcggttcttgcgcagcccggcccaatggctccgcgccatcggcgag
taccggggcagcatcagcgccactccgaatttcggcttggcgtacgcggcggcacggatc
ggggaggccgagctcgatgcggtcgacgtctccagcatgcggagaattttttgcggagct
gagccggtcggccgccgcgacgtcgaggcgttcaccgagcggttcgcccgccacgggctg
ccggctgacgcggtggttccctgctacgggctcgctgaggccacactcattgtcactgcc
gcaagccccagcgagtccttgcgcgccgatattgtttcgcggcgcgcgctggcggcgcag
ggccgcgctgtgcccgccgtccaaggcgaccctgacgcccaagaggtggtggaagtcggc
caggctgtccgaggaaccgagatccgggtcgtggacgaggctgacgggccggtcgccgac
ggcgttctgggcctggtgcagttccgagggccgtcccgaaccgacggctattacgagttg
cctgaggccacggcggattgcttacggccgggcggttggtggaacactggcgacatcgga
tacatgcggcgcgggagtttgcggatcaccgggaggcaacgcgatctcatcgtgatccgg
ggcgccaactacttcccggacgatttcgagcgggccgcgcaatcggtcgacggcgtcgtg
cccggcgcggtcgtcgccactggcgaccatgacgcggcctgcggcaccgagcagctgtgc
ctcattgtggaggtcgcggcagaagccggcagctatcgcgagctggatcgttctatccgg
gccgcagtgagcgcccagaccggtgtcgccgtgtcacgggtcgttttcgtgccccggcac
agcattccgaagaccaccagcggcaaggtccgccgcgccttggcccgccagaggttcgtc
gtcgaggccggtcccggcgacgtcgcggccctcggttga

DBGET integrated database retrieval system