KEGG   Segniliparus rotundus: Srot_2057Help
Entry
Srot_2057         CDS       T01238                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
srt  Segniliparus rotundus
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Srot_2057
   00620 Pyruvate metabolism
    Srot_2057
  Nucleotide metabolism
   00230 Purine metabolism
    Srot_2057
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Srot_2057
Membrane trafficking [BR:srt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Srot_2057
Exosome [BR:srt04147]
 Exosomal proteins
  Proteins found in most exosomes
   Srot_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2079530..2080951)
Genome map
AA seq 473 aa AA seqDB search
MTRHTKIVCTLGPATASAQKVKALVEAGLDVARLNFSHGDHPDHEQMYHWVREASDQTGR
AVGIMADLQGPKIRLGRFAEGRTIWATGETVRITVDDIEGSHDRVSTTYKQLANDVVAGD
TLLIDDGKVGLRALRVEGNDVVCQVYEGGPVSNNKGISLPGVNVSAPALSEKDTEDLEFA
LRLGVDWVALSFVRSPDDVRLVHEVMDRVGRRVPVIAKLEKPEAVGDQLEEVILAFDAVM
VARGDLGVELPLEDVPAVQKRAIQLARANAKPVIVATQVLESMIENATPTRAEASDAANA
VFDGADAVMLSGETSVGKHVFVAVRTLARILAAAEKEPALIAPLIRIPRTKSGVISYSAK
DIGERLEAKALVAFTQSGDTVRRLARLHSALPLLAFTPVPAVRSRLALSWGVETFIVPQV
DSTDSMIRLVDQALLDIKRYEQGDLVIVVAGAPPGTVGSTNTINAHRIGEHDH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgactcgccacacaaagatcgtctgcaccttgggccctgccaccgcgtctgctcaaaaa
gtcaaagctctcgtcgaagcgggtctggatgtggcgcggctgaacttcagccacggggac
cacccggaccacgagcagatgtaccactgggtgcgcgaggcttccgaccagaccggccga
gcggtggggatcatggccgatctgcaagggccgaaaatccggcttggccgcttcgccgag
gggcgcaccatctgggcgaccggcgagaccgtccggatcacggtcgatgacattgaagga
tcccacgaccgggtttctaccacctacaagcagctcgcgaacgacgtcgtcgcgggggac
accctgctcatcgacgacggcaaggtcgggctgcgggcgttgcgcgtcgagggcaacgac
gtggtctgccaggtgtacgagggcggtccggtcagcaacaacaaaggcatctccctgccc
ggtgtgaacgtctcggctccggcgttgtcggagaaggacaccgaggacctcgagttcgcc
ctgcggctcggggtggactgggtcgcgctgtccttcgtccgctcgcccgacgacgtgcgt
ctggtccacgaggtgatggaccgagtcggcaggcgcgtcccggtcatcgcgaagctggag
aagccagaggcggtgggggaccagctcgaagaggtgatcctcgcgttcgacgcggtcatg
gtggcccgaggcgatttgggcgtcgagctgcccctcgaagacgtgccagcggtccagaag
cgcgcgatccagctcgccagggccaacgcgaagccggtgatcgtggcgacccaggtgctg
gagtcgatgatcgagaacgccacccccacgagggcggaggcgtccgacgccgccaacgcg
gtgttcgacggcgcggacgcggtcatgctgtcgggggagacctccgtcggcaagcacgtc
ttcgtcgcggtccgcacgctggcccggatcctcgcggcggcggagaaggagcccgcgctc
atcgcgccgctcatccggataccgaggacgaaaagcggcgtcatctcgtactcggccaaa
gacatcggggagcggttggaggcgaaggcgctggtcgctttcacgcagtccggcgacacg
gttcgtcgtctcgcccgattgcacagcgcgttgccgttgctcgcgttcaccccggtgccc
gcggtccgcagcaggctcgcgttgtcgtggggcgtggaaacgttcatcgtgccgcaagtg
gactccaccgactcgatgatccggctggtggaccaggccctgctggacatcaaacggtac
gagcaaggcgacttggtcattgtcgtggcaggagccccgccggggacggtgggctccacc
aacacgatcaacgcccaccgcatcggcgaacacgaccactag

DBGET integrated database retrieval system