KEGG   Salinibacter ruber DSM 13855: SRU_1027Help
Entry
SRU_1027          CDS       T00312                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00230  Purine metabolism
sru00620  Pyruvate metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
sru01230  Biosynthesis of amino acids
Module
sru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sru_M00002  Glycolysis, core module involving three-carbon compounds
sru_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sru_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1027 (pykA)
   00620 Pyruvate metabolism
    SRU_1027 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    SRU_1027 (pykA)
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SRU_1027 (pykA)
Membrane trafficking [BR:sru04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SRU_1027 (pykA)
Exosome [BR:sru04147]
 Exosomal proteins
  Proteins found in most exosomes
   SRU_1027 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 3851070
NCBI-ProteinID: YP_445159
UniProt: Q2S3S2
LinkDB All DBs
Position
1307678..1309108
Genome map
AA seq 476 aa AA seqDB search
MDRRTKIVCTLGPATTDPETLRRLVAAGMDVARMNFSHGTHEEHRERVETVREVAEAEGK
GITVLQDLQGPKIRVGAVQNDSVMLAEGDEVRVSTDTPRESTNEHIFIDYEALARDAREG
ERILIDDGLLELRVIETNGSQLRATVVEGGPLRSRKGVNLPDLQASTPPMTEKDLKDLEL
GLELEVDVVALSFVQERSDVEALVHRIEETGKKTSVVAKIEKPQAVHNIDEILEVVDGIM
VARGDLGIEMPMEEVPGTQKRLIRKSMEAAKPVITATQMLESMVEDPRPTRAEASDVANA
VLDGSDAVMLSAETAVGDHPVRVVEAMNQIIRQAESYWHEERRALTMTPDHFEQGANVTN
SVSFTACRLAEQVGAEAICCLTNSGSTARSIARHRPSMPIYAFTDNKRVVAQLGSLWGTE
AFYIPFQQDTDQGIARVHGVLHDYDLVRSGGHVVLTVGMPLPARGRTNTVHVSTVQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgaacaaaaatcgtttgcacgctgggcccggccacgacggacccggaaaca
ctccgtcgtctggtcgcggccggaatggacgttgcccgaatgaacttctcacacggcacc
cacgaggagcaccgggagcgcgtggaaaccgttcgggaggtggccgaggcggaagggaag
ggcataacggtgttgcaggaccttcagggccccaaaattcgagtgggggcggtacagaac
gactcggtcatgctggcggagggcgacgaagtgagggtgagcaccgacaccccgcgggag
agcacgaacgagcacatcttcatcgactacgaggccctcgcccgggacgcccgagagggg
gagcgcattctgatcgacgatggcctgctggaactccgggtcatcgagacgaacggctcg
cagctccgggcgacggttgtggaaggggggccgctgcggtctcgaaagggggtaaatctg
cccgacctgcaggcctccacgcccccgatgacggagaaggacctgaaggacctcgagctc
gggctcgaattggaggtcgacgtcgtagccctctcgttcgtgcaggaacggtccgacgtg
gaggcgctggtccaccgcatcgaggagaccgggaagaagaccagcgtcgtggccaagatc
gagaagccccaggccgtccacaacatcgacgagattctggaggtcgtggacggcatcatg
gtggcgcggggcgacctcggcatcgagatgccgatggaagaggtgcccggcacccagaag
cggctcatccgcaagagcatggaggccgccaagcccgtcatcacggccacgcagatgctc
gagagcatggtggaggacccgcgcccgacccgcgccgaggcgagtgacgtggccaacgcg
gtcctcgacggcagcgacgcggtgatgctttctgccgagacggcggttggggatcatccg
gttcgggtcgtggaggcgatgaaccagatcatccgtcaggccgagtcctactggcacgag
gaacgacgggcccttaccatgacgcccgatcactttgagcaaggggcgaacgtaacgaat
agtgttagcttcacggcctgtcgcctcgccgagcaggtgggggcggaggccatctgctgc
ctgaccaactcggggtcgaccgctcgctccatcgcccgacaccggcccagcatgcccatc
tacgccttcaccgacaacaaacgggtggtggcccagcttggaagcctctggggcaccgag
gccttctacatccccttccagcaagacaccgaccagggcattgcgcgtgtgcacggcgtc
ctgcacgactacgacctggtgaggtcgggcggccacgtggtgctgaccgtcggaatgccg
ctgccggcccgcgggcgcaccaacaccgtccacgtcagcaccgtgcagtag

DBGET integrated database retrieval system