KEGG   Salinigranum rubrum: C2R22_09410Help
Entry
C2R22_09410       CDS       T05289                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srub  Salinigranum rubrum
Pathway
srub00564  Glycerophospholipid metabolism
srub01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srub00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2R22_09410
Enzymes [BR:srub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2R22_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox 3HCDH_N NAD_binding_7 Pyr_redox_3 ApbA
Motif
Other DBs
NCBI-ProteinID: AUV81839
UniProt: A0A2I8VL80
LinkDB All DBs
Position
complement(1906852..1908096)
Genome map
AA seq 414 aa AA seqDB search
MTHRTDVLVVGGGATGAGVARDLALRGVDVTLAERGGLSSGTTGRSHGLLHSGARYAEAD
EVGARECIAENRILRDIAGHCVGDTGGLFLQLAADDPDYFDAKLAACREYGIDAEVISDE
EARERVPDLAPEVERAMIVPDAVVYPSRLVAANAADVEQRGGTVLRDAPLESFTVEDGRI
VGTRLGGSANVDVAATYVVNSTGAWAGQVAEKAGVDVEMRPTSGVMVSVDYADLGPVLNR
CREPDDGDIVIPHDDQVVLGTTSNVVDDPDDYPQDEGEIQKMFDECGDMLPAVRDCETLR
AWWGVRPLYAPDEDSRRSQSGGRGANRGISRGFFVLDHAEEVENFASVVGGKLTSYRLMA
EQTADLVADRLDVDEPCRTAEEPLPGADDPTTLNEFVSAYDARSPTDEDVVADD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccgaacggacgtgctggtggtcggcggtggcgcaaccggtgcgggtgtcgcc
cgcgacctcgccctccgcggggtcgacgtgacgctcgcagagagggggggactctcctcg
gggacgacggggcggtcacacggcctcctccacagcggcgcccggtacgccgaggccgac
gaggtcggcgcccgcgagtgcatcgcggagaaccgcatcctccgcgacatcgccgggcac
tgcgtcggcgacaccggcgggctcttcctccaactcgcggcggacgaccccgactacttc
gacgcgaagctcgcggcctgtcgcgagtacggcatcgacgccgaggttatctcggacgag
gaggcacgcgagcgcgtcccggacctcgcccccgaggtcgaacgggcgatgatcgtccct
gacgccgtcgtctacccctcgcggctcgtcgcggccaacgcggccgacgtcgagcaacgc
ggcggaaccgtcctgcgggacgccccgctggagtcgtttaccgtcgaagacggccgcatc
gtggggacgcgactcggggggagcgcgaacgtcgacgtcgcggcgacgtacgtggtgaac
tcgacgggcgcgtgggcggggcaggtcgccgagaaggccggcgtcgacgtcgagatgcgc
cccacgagcggcgtgatggtctcggtcgactacgccgacctgggaccggtcctcaaccgg
tgtcgcgaaccggacgacggcgacatcgtcatcccgcacgacgaccaggtcgtcctgggg
acgacgagcaacgtcgtcgacgaccccgacgactacccccaggacgagggggaaatccag
aagatgttcgacgagtgcggcgacatgctccccgccgtccgcgactgtgagaccctccgg
gcgtggtggggcgtccggccgctgtacgcgcccgacgaggactcccggaggagccaaagc
ggcgggcggggggcgaaccgcggtatctcccgcgggttcttcgtcctcgaccacgccgag
gaggtagagaacttcgcgagcgtcgtcggcgggaagctgacctcctaccggctgatggcc
gagcagacggcggacctcgtcgccgaccgtctcgacgtcgacgagccgtgtcgaaccgcc
gaagagcccctccccggcgcggacgaccccacgacgctgaacgagttcgtctcggcgtac
gacgcgcgttccccgaccgacgaggacgtcgtcgcggacgactga

DBGET integrated database retrieval system