KEGG   Streptomyces reticuli: TUE45_00042Help
Entry
TUE45_00042       CDS       T04246                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
srw  Streptomyces reticuli
Pathway
srw00020  Citrate cycle (TCA cycle)
srw00480  Glutathione metabolism
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
srw01120  Microbial metabolism in diverse environments
srw01130  Biosynthesis of antibiotics
srw01200  Carbon metabolism
srw01210  2-Oxocarboxylic acid metabolism
srw01230  Biosynthesis of amino acids
Module
srw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TUE45_00042 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TUE45_00042 (icd)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TUE45_00042 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF3322 Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: CUW25332
UniProt: A0A0U5EHR5
LinkDB All DBs
Position
I:complement(43603..45822)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTYTDEAPALATHSFLPVIQAYASQAGVPVETRDISLAGRIIAVFPEYLNEDQ
RIPDALTELGELAKTPAANIIKLPNISASIPQLKAAIAELQGKGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTAESKTNVATMGEND
FRSTEKSVVIAEDGTLKIELVGEDGTTTVLKESVPVLAGEVVDASVMRVAELNAFLAAQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGETLKAAGLSPNDGLGGI
LKGLESLPEGAAIKASFDAEIAEGPDLAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGADGQEHDALAVIPDSSYAGVYQAVIDDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPAAGTVRLTDQAGNVLIEQPVAQGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKQYLPEHDTEGLDIRILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSFEQYAAATGNTRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTEDADLAKAFAPLAETLAANEQKIVDELNAVQGSPADIGGYYQVDKAK
ADAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacctacacagacgaggccccggccctggcgacgcat
tcgttcctgccggtgatccaggcgtacgcctcgcaggccggtgtgcccgtggagacccgc
gacatctcgctggccgggcgcatcatcgccgtcttcccggagtacctgaacgaggaccag
cgcatccccgacgcgctgaccgagctgggtgagctggccaagacccccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctgaaggccgccatcgccgagctg
cagggcaagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggttccgccgtgaacccggtcctgcgtgag
ggcaactccgaccgccgcgccccggcctcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccgccgagtccaagaccaacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgtcgtcatcgccgaggacggcacgctcaagatcgagctg
gtcggcgaggacggcaccacgaccgtcctgaaggagtccgtaccggtcctggcgggcgag
gtcgtcgacgcgtccgtcatgcgcgtcgccgagctgaacgcgttcctcgccgcgcaggtc
gcccgcgccaaggccgagggcgtcctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacgtggtgcgcgccttcttcccgaagacgttcgcg
cagtacggcgagaccctgaaggcggccggcctctccccgaacgacggcctcggcggcatc
ctgaagggcctggagagcctgcccgagggcgccgcgatcaaggcctccttcgacgccgag
atcgccgagggcccggacctggccatggtcgactcggacaagggcatcaccaacctgcac
gtgccgtcggacgtcatcatcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcgcggacggccaggagcacgacgccctcgccgtcatcccggactcctcctac
gccggtgtctaccaggccgtcatcgacgactgccgggccaacggcgcctacgacccgtcc
accatgggctcggtgccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcccggccgccggcaccgtccgcctgaccgaccaggccggc
aacgtcctgatcgagcagccggtcgcgcagggcgacatcttccgcgcctgccagaccaag
gacgccccgatccgcgactgggtcaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtgttctggctggacgagggccgcgcccacgacgccaacctgatcgccaaggtc
aagcagtacctgccggagcacgacaccgagggcctggacatccgcatcctgtccccggtc
gaggccaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtgacc
ggcaacgtcctccgcgactatctgaccgacctcttccccatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgccgaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tccctcggtgagttcttcgccctggtgccgtccttcgagcagtacgcggcggccaccggc
aacacccgcgccaaggtcctcgccgacaccctggaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcccggcagaccgaggacgccgacctcgcgaag
gcgttcgcgccgctcgccgagaccctcgccgcgaacgagcagaagatcgtggacgagctg
aacgccgtccagggctccccggccgacatcggcggctactaccaggtcgacaaggccaag
gcggacgcggtcatgcgcccgtcggccacctggaacgaggcgctggcgtccctgagctga

DBGET integrated database retrieval system