KEGG   Streptomyces reticuli: TUE45_02874Help
Entry
TUE45_02874       CDS       T04246                                 

Definition
(GenBank) Putative fatty-acid--CoA ligase fadD21
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(3333387..3335144)
Genome map
AA seq 585 aa AA seqDB search
MTHPSPLDEPTALHLLRRHAAERPGRAAVTFVHDHDAADGARTLDYAALDAEARRVASWL
QERCAPGDRVLLLHPPGLPFVTAFLGCLYAGTVAVPSPMPGQFQYQQRRVTRIALDAGVG
VALTDSGQLEEARRWIETENLGFTVAASDTDGFGAADAWRDPGATAGDLVLLQYTSGSTG
DPKGVMVDHGNLLHNADSLRRALGLTEDTNFGGWIPLYHDMGLMGQLLPSLFLGSHCALM
SPMAFLKRPHQWLSLLDRYDVGYSAAPNFAYELCVRRVTDAQLAGLDLSRWTFAANGSEP
IQASTLRDFAERFAPAGFRAEALAPCYGMAEATVFVSGLAGRPPRVEPVDSDALEKHVLQ
PPLPEGPVRELVGCGNVPDFDVRIVDPADGTVLPDGTTGEIWLRGPSVAAGYWGRPDATE
ETFGARTADGDGPFLRTGDLGALVDGEIYVTGRSKDLLIVHGRNLYPQDIEHELRRRHPE
LATLAGTAFTVPVPQEEVVVLHEIRGRFTDEQYAELSRALRTTVYQEFGVRTAGLVLLRP
GSVRKTTSGKVQRSEMRRLFLDGALTPLHAHLEPAVRELVGEVPA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacccctccccgctggacgaacccaccgccctgcacctgttgcgccggcacgcc
gccgagcggcccggccgcgccgcggtcaccttcgtccacgaccacgacgcggccgacggc
gcccgcaccctggactacgcggccctggacgccgaggcccgccgcgtcgcctcctggctc
caggagcgctgcgcgcccggcgaccgcgtcctgctgctgcacccgccgggcctgcccttc
gtcaccgccttcctcggctgcctgtacgccggcacggtcgccgtgccctcgccgatgccc
ggccagttccagtaccagcagcgccgggtcacccggatcgccctggacgccggggtgggc
gtcgcgctcaccgacagcgggcagctggaggaggcgcgccgctggatcgagaccgagaac
ctgggcttcaccgtggcggccagcgacaccgacggcttcggtgccgccgacgcctggcgt
gatcccggggccaccgccggcgacctggtcctgctccagtacacctccggctcgaccggc
gacccgaagggcgtcatggtcgaccacggcaacctgctgcacaacgccgacagcctgcgc
cgcgccctcgggctcaccgaggacaccaacttcggcggctggatcccgctgtaccacgac
atgggcctgatggggcagctgctgcccagcctcttcctcggcagccactgcgccctgatg
tccccgatggccttcctcaagcgcccccaccagtggctcagcctcctcgaccgctacgac
gtcggctactcggccgcccccaacttcgcctacgagctgtgcgtgcgccgggtcaccgac
gcccagctggccggtctcgacctgtcccgctggacgttcgccgccaacggctccgaaccc
atccaggcctccaccctgcgcgacttcgccgagcggttcgccccggccggcttccgcgcc
gaggccctcgccccctgctacggcatggccgaggccaccgtgttcgtctccggcctggcc
ggccggccgccccgggtggagcccgtcgactccgacgccctggagaagcacgtcctccag
ccgccgctgcccgagggaccggtccgcgaactggtcggctgcgggaacgtaccggacttc
gacgtacggatcgtcgacccggccgacggcaccgtgctgcccgacggcaccaccggagag
atctggctgcgcggtcccagcgtggccgccggctactggggccgcccggacgccaccgag
gagaccttcggcgcgcgcaccgccgacggcgacggaccgttcctgcgcaccggcgacctg
ggcgcgctggtggacggcgagatctatgtgaccggccgcagcaaggacctgctgatcgtg
cacggccgcaacctctacccccaggacatcgagcacgagctgcgccgccgccaccccgag
ctggccacgctcgccggcacggcgttcaccgtgcccgtgccgcaggaggaggtcgtcgtc
ctgcacgagatccgcggccggttcaccgacgagcagtacgcggagctgtcccgggccctg
cgcaccaccgtctaccaggagttcggggtgcgcacggccggcctggtgctgctgcgcccc
ggatccgtccgcaagaccaccagcggcaaggtgcagcgctccgagatgcgccggctcttc
ctcgacggcgcgctcaccccgctccacgcccatctggagcccgcggtgcgcgagctggtc
ggcgaggtccctgcgtga

DBGET integrated database retrieval system