KEGG   Streptomyces reticuli: TUE45_04092Help
Entry
TUE45_04092       CDS       T04246                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
srw  Streptomyces reticuli
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    TUE45_04092 (kynU)
Enzymes [BR:srw01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TUE45_04092 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:4708101..4709285
Genome map
AA seq 394 aa AA seqDB search
MSELPLLAKKLDEADELAPLRDRFVLDEVVYLDGNSLGALPAHVPDRVADVVRRQWGELR
IRSWEESGWWTAPERIGDRIAPLVGAAPGQIVVGDSTSVNVFKALVAAIRMADDSRDELL
VDATTFPTDGYIAESAARLTGRTLRPVTPAEVPGALGDRTAAVLLNHVDYRTGRLHDLPA
LTAAIHACGALAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAYLYVRSALQ
DRFDSPLPGWNSHAEPFGMSPAYTPAAGALRGRVGTPDILSLLALEAALDVWDGVSVTAV
RAKSLALTDFFLRCVGEYTEPGRVECVTPEAHTERGSQIALRCPDAGEVMKRLIARGVVG
DFRHPDVLRFGFTPLYTGFRDAERAARALGEELA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctgcccctgctcgcgaagaagctggacgaggccgacgaactggcgcccctg
cgggaccgcttcgtcctggacgaggtcgtctatctcgacggcaactccctgggcgccctt
cccgcgcacgtccccgaccgggtcgcggacgtcgtccggcgccagtggggcgaactgcgc
atccggtcctgggaggaaagcggctggtggacggcgcccgagcggatcggcgaccggatc
gccccgctggtcggcgcggcacccggccagatcgtcgtcggcgactcgacgagcgtcaac
gtcttcaaggcgctcgtggccgcgatccgcatggcggacgacagccgtgacgaactcctg
gtggacgcgaccacctttcccacggacgggtacatcgccgagtccgcggcccggctgacc
ggccgcaccctgcgcccggtgaccccggccgaggtgcccggggcgctgggcgaccgcacc
gcggcggtgctgctcaaccacgtcgactaccgcaccggccggctgcacgacctgcccgcc
ctcaccgccgcgatccacgcctgcggcgccctcgcggtctgggacctgtgccacagcgcg
ggcgcgctgccggtcggcctggacgagcacggcgtcgacctcgcggtcggctgcacctac
aagtacctcaacggcggcccgggttcaccggcgtacctgtatgtgcgcagcgcgttgcag
gaccgcttcgactccccgctgcccggctggaactcgcacgccgagccgttcggcatgagc
ccggcctacaccccggcggcgggcgccctgcgcggccgggtcggtacgccggacatcctc
tccctgctggcgctggaggccgcgctcgacgtctgggacggggtgtccgtcaccgccgtc
cgcgccaagtccctggcgctgacggacttcttcctgcgctgcgtgggcgagtacaccgag
cccggccgggtggagtgcgtgacccccgaggcgcacacggaacggggcagccagatcgcc
ctgcgctgcccggacgcgggcgaggtgatgaaacgcctgatcgcccggggcgtggtgggc
gacttccgccaccccgacgtcctccgcttcggcttcaccccgctgtacacgggcttccgg
gacgcggaacgggcggcccgggcgctgggggaggagctggcctag

DBGET integrated database retrieval system