KEGG   Streptomyces reticuli: TUE45_06959Help
Entry
TUE45_06959       CDS       T04246                                 

Gene name
aml_3
Definition
(GenBank) Alpha-amylase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
srw  Streptomyces reticuli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TUE45_06959 (aml_3)
Enzymes [BR:srw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TUE45_06959 (aml_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(7860200..7862263)
Genome map
AA seq 687 aa AA seqDB search
MSLMAPARRRMPAALAGAGLILGLATALTAPAQQAAAAPTANGDKKVTAVLFEWNFDSIA
RECTRTLGPKGYGYVQVSPPQERIQGSAWWAAYQPVSYKIQGPLGDRDDFRNMVDTCHGA
GVKVVVDAVLNHMTSGSGTGTAGTQYSKYNYPGTYSDADFHGCRRPVGTDYKDRYNVQEC
ELGETGQPSLADLDTGSDSVRGKIAGYLNDLLSLGVDGFRMDAVKHIAATDLAAVRGRLT
NPNVHWMQEAIHGAGEAVSPNEYLATGDVQEFRYTTDLKRTLTGEKLAYLKNFGEGWGYM
PSGQSGVMVANHDTERNGSSLSYRDGATYMLAHVFMLAHPYGAPSVHSGYEFSNRDAGAP
NGHTVDTCHSDGWSCQHAWRQVANMVAFRNVSEGTGLTDWWDNGNNAVAFGRGSKAFVAI
NHEGRALTQTFQTSLPAGTYCDVQHGDPTASGGCTGTTYTVGTDGKFTATIGSDDAVALH
IGATAGDKPGDSTVTVYYSTDKNWSAYNIHYAPTGGTWTTSPGAAMQSACTGWVKKSISL
GSATGLKAAFNNGSGTWDNNNGADYALGTGDITVRNGTVGTGNPCAVQQTEPGASFAVNA
TTVPGQNLYVVGNQAALGNWAPTAALKLDPAAYPVWKLDVKLPAGTSFEYKYIRKDASGD
VTWESGANRTATVPADGKVTLNDTWRN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgatggcacctgctcgacgacgaatgcccgccgccctggcgggcgccggtctg
atcctcggtctggccaccgccctcaccgcgcccgcccagcaggcggccgcggcgccgacg
gccaacggtgacaagaaggtcaccgccgttctgttcgagtggaacttcgactcgatcgcc
cgcgagtgcacgcgcaccctcggccccaagggctacgggtacgtgcaggtctcgccgccg
caggagcgcatccagggcagtgcgtggtgggccgcgtaccagccggtcagctacaagatc
cagggaccgctcggcgaccgcgacgacttccggaacatggtcgacacgtgccacggcgcc
ggcgtgaaggtcgtcgtcgacgccgtactcaaccacatgacgtccggctcgggcaccggt
accgccggcacgcagtacagcaagtacaactatcccggcacctactcggacgcggacttc
cacggctgccgccgccccgtcggcaccgactacaaggaccgctacaacgtgcaggaatgc
gagctcggcgagacggggcagccctcactcgcggacctcgacaccggcagcgactccgtc
cgcggcaagatcgccggatacctcaacgacctgctgtcgctgggtgtcgacggcttccgc
atggacgccgtcaagcacatcgccgccaccgacctcgccgccgtccgcggcaggctcacc
aacccgaacgtccactggatgcaggaagccatccacggcgcgggcgaggccgtctcgccg
aacgagtacctggcaaccggcgacgtccaggagttccgctacaccaccgacctcaagcgc
accctcaccggcgagaagctggcctacctcaagaacttcggtgagggctggggttacatg
ccctccggccagagcggcgtcatggtcgccaaccacgacaccgagcgcaacggctccagc
ctgagctaccgcgacggagcgacctacatgctcgcccacgtcttcatgctcgcccatccg
tacggcgccccgtccgtccactccgggtacgagttcagcaaccgggacgccggcgccccc
aacgggcataccgtcgacacctgtcacagcgacggctggagctgccagcacgcctggcgc
caggtcgccaacatggtggccttccgtaacgtctccgagggcaccggcctcaccgactgg
tgggacaacggcaacaacgccgtggccttcgggcgcggcagcaaggcgttcgtcgccatc
aaccacgagggccgagccctcacccagaccttccagacctccctcccggccggcacctac
tgcgacgtccagcacggcgacccgaccgcgagcggcggctgcaccggcaccacgtacacc
gtcggcacggacggcaagttcaccgccaccatcggcagcgacgacgccgtagccctgcac
atcggcgcgacggccggggacaagccgggcgacagcacggtgaccgtctactacagcacg
gacaagaactggtcggcctacaacatccattacgccccgaccggcggcacctggaccacc
tcacccggcgccgccatgcagagcgcgtgcaccggctgggtgaagaagagcatcagcctc
ggctccgccaccggcctgaaggcggccttcaacaacggctccggcacctgggacaacaac
aacggcgccgactacgccctcggcaccggcgacatcacggtccggaacggcaccgtcggc
accggcaacccctgtgccgtccagcagaccgaaccgggcgcgtccttcgcggtcaacgcc
accaccgtccccggccagaacctctacgtcgtcggcaaccaggccgccctcggcaactgg
gcgccgaccgccgccctcaagctggaccctgccgcctacccggtgtggaagctcgacgtg
aagctgcccgcgggcacgtccttcgagtacaagtacatccgcaaggacgcctccggcgac
gtcacttgggagagcggcgccaaccgcacggccacggtccccgccgacggcaaggtcacg
ctgaacgacacctggcgcaactga

DBGET integrated database retrieval system