KEGG   Streptomyces reticuli: TUE45_07257Help
Entry
TUE45_07257       CDS       T04246                                 

Gene name
ykoU
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:8223468..8224463
Genome map
AA seq 331 aa AA seqDB search
MGGRTVRLSSPDKVFFPERGFTKLDLARYYTAVGPGILRALRNRPTTLERYPDGVGGEWF
FQKRAPKGMPDWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWPVRATDVDR
PDELRIDLDPQPGTDYADAARAAHELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEPRWTF
TQVRRAAIAVGREMERRMPEQVTIKWWKEERGRRIFLDYNQTARDRTIASAYSVRPRPHA
PVSAPLRWEEVGVAQPRDFDLATMPARFAELGDVHADMDDHAYSLDALLELARRDEHDHG
LADLPYPPEYPKMPGEPKRVQPSRARREPSS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggccggaccgtacggctgtccagcccggacaaggtgttcttcccggagcgcggt
ttcaccaagctggacctcgcccggtactacaccgccgtcggccccggcatcctgcgcgcc
ctgcgcaaccgccccaccaccctggagcgctacccggacggcgtcggcggcgaatggttc
ttccagaagcgggcccccaagggcatgcccgactggatcccgaccgcccacatcaccttt
cccagcgggcgcagcgccgacgagatgtgcccgaccgaggaggccgccgtggtgtgggcc
gcccagtacggcaccctcaccttccacccctggccggtgcgcgccaccgacgtcgaccgc
cccgacgaactccgcatcgacctcgacccgcagcccggcacggactacgccgacgcggcc
cgcgccgcccacgaactgcgcgccgtgctggacgagttcggcgggctgcgcggctggccc
aagacctccggcggccggggcctgcacgtcttcgtccccatcgaaccgcgctggaccttc
acccaggtgcgccgcgcggcgatcgcggtggggcgggagatggagcgccggatgcccgag
caggtgaccatcaagtggtggaaggaggaacgcgggcgccgtatttttctcgactacaac
cagacagcgcgagatcgcaccatcgcgtccgcctactccgtacgtccccgcccgcacgcc
cccgtctcggcaccgctgcgctgggaggaggtcggcgtcgcccagccccgcgacttcgac
ctcgcgaccatgccggcccggttcgccgaactcggtgacgtgcacgccgacatggacgac
cacgcctactcgctggacgcgctgctggaactggcccgccgggacgaacacgaccacggc
ctggccgacctgccgtacccgccggagtacccgaagatgcccggcgaaccgaaacgcgtc
cagccgagccgggcccggcgcgaaccgtcgtcctga

DBGET integrated database retrieval system