KEGG   Sinocyclocheilus rhinocerous: 107707496Help
Entry
107707496         CDS       T04916                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107707496
  Amino acid metabolism
   00310 Lysine degradation
    107707496
   00380 Tryptophan metabolism
    107707496
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     107707496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1008 aa AA seqDB search
MSQLRSLAGALRSSSQWMRGHVGTGGRVFDPRRNCSSGAAEPSLAACSSSYVVEMYYAWL
EDHKNVHESWDAYFRNAQASGSEETGEKRLSALLQGRAMSQTPAMSEKVVEDHLAVHTLI
RAYQVRGHHVARLDPLGILTADLDSFVPSDLITSIDKLGSYGLEESDLDKSFQLPLTTFI
GGNESTLPLREIIHRLETSYCGHTGVEFMFINNMEQCQWIRQKFETPGIMTFSDREKRTL
LARLVRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKMIIDKSSEAGVESVIMGMPHRGR
LNVLANVVRKDLDQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRETDKNITLSLMANP
SHLEAVDPVVQGKTKAEQFYRGDTEGRRVMSILMHGDAAFAGQGVVYETFHLSELPSYTT
HGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCKVAAEWR
NTFNKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKQIRKQEHVLKKYADKLISEGVVTLQE
FEEEVAKYDKICEEAYTSSKDEKILHIRHWLDSPWPDFFKPDGEPKSMSCPSTGLNEEVL
RHIGEVASSVPLKDFAIHSGLSRILRGRADMVAKRTMDWALAEYVAFGSSLKDGIHVRLS
GQDVERGTFSHRHHVLHDQEVDKRFCIPMNHLWPNQALYTVCNSSLSEYGVLGFELGFAM
ASPNALVCWEAQFGDFQNTAQCIIDQFISAGQAKWVRHNGIILLLPHGMEGMGPEHSSAR
PERFLQMSKDDPDRYPEFTGDFEVQQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLI
IFTPKSLLRLPEAHSSFDEMITGTKFLRIIPDGGPASKHPEKVKRVIFCTGKVYYELAKE
RKQLKLEEDVAIVRLEQISPFPFDLIKAEVEKYSNAELIWCQEEHKNMGYYDYIRPRFLT
VHSKNPIWYVGRDPAAAPATGNKFTHLAELKRFLDTAFNLEAFKGRSF
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgaggtccctagctggtgccctaagaagcagtagccaatggatgaggggg
cacgtggggacaggggggcgagtttttgacccacgtcgtaactgttcgagcggggctgct
gagccctcattggcagcctgcagctccagctatgtcgtggagatgtactacgcttggctg
gaggatcacaaaaatgttcatgagtcttgggatgcatactttcgtaacgcccaagccagc
ggttcagaggagactggagagaagcgtctgtctgcgctgctccaggggcgagccatgtcc
cagacacctgccatgtccgagaaggtggtggaggatcatttggcagtccacactcttatc
agagcctatcaggtacgtggtcaccatgtggccaggctggaccctcttggcatcctcact
gccgatctggattccttcgttccctcagatttaatcacgtcaattgacaagcttgggtcc
tacggcttggaagaatctgatctggataaatcatttcagttgccactaaccacatttatc
gggggaaatgaaagcacactcccactgagagaaatcatacacagacttgagacatcatac
tgtggtcatactggagtggaattcatgttcatcaacaatatggagcagtgccagtggatc
cgacagaagtttgaaactcctggaatcatgacattttctgacagagagaagaggactttg
ctggccaggctggttcgctcaacacggtttgaggattttcttgctcggaaatggtcttca
gagaaacgctttggtttggaaggctgtgaggttctcatccctgccctgaagatgatcatt
gacaagtccagtgaagctggtgtagagagtgtaattatgggaatgcctcacagaggccga
ctgaacgtcctggccaatgtagttcgcaaagatctggatcagatattctgtcagttcgat
cccaaacttgaggctgcagatgagggttcaggagatgtgaaatatcacttggggatgtac
catgaacggataaacagggaaacagataagaatatcacattgtctctgatggcaaacccc
tctcacctggaggcagtagatcctgtcgttcagggcaagaccaaggcagagcagttttac
agaggagacactgaaggaaggagggtgatgtctattttaatgcatggtgacgctgctttt
gcgggtcagggagtcgtctacgaaaccttccatctcagtgaactgccttcatataccact
catggcaccatccatgttgtggtcaataatcagattggattcaccacagatccccgaatg
gcacgttcctctccctacccaacggatgtggctcgcgtagtcaacgcacccatcttccat
gtcaacgctgatgacccagaggctgttatgtatgtttgtaaggttgctgcagaatggaga
aacactttcaacaaggatgtggtgatagacctggtgtgttaccggcggtttggacataat
gagatggatgagcccatgttcactcaacccctcatgtacaagcagatccggaaacaggaa
catgtgctgaagaagtacgccgacaagctcatctctgagggagttgtaacactgcaagag
tttgaggaggaggttgctaaatatgacaagatctgtgaggaggcgtataccagctctaaa
gatgagaagatcctacacatccgccactggcttgactctccgtggccagacttcttcaaa
ccagatggagagccaaagagcatgagctgcccttccactggactaaacgaagaggtgctc
aggcacattggtgaggtagccagttcagtccctctgaaggattttgcaattcacagtggc
ttgtcacgtatccttcgaggcagagcagatatggttgcgaagcgcacgatggactgggcc
ctggcagagtacgtggccttcggctcttcgctgaaggatggtattcacgtgagactcagt
ggacaagatgtggaaagaggaacatttagtcaccgtcaccacgtcttgcatgatcaggaa
gttgataagcgcttctgcattccgatgaaccacctatggccgaaccaggctctctacaca
gtgtgcaacagctccctgtctgaatatggggttttggggtttgagctgggttttgccatg
gctagtcctaatgccctggtgtgctgggaggctcagtttggcgacttccaaaacacagcc
cagtgcatcatagaccagttcatctctgcaggccaggccaagtgggtccgtcacaatggc
atcattttactgttgcctcatgggatggagggaatgggcccggagcactcgtcagcacgg
cctgagcgcttcctgcagatgagcaaggatgaccctgatcgctatccggaattcactgga
gactttgaggtccagcagctctatgactgtaactggatcgtggtcaattgttcaacacct
gccaactacttccatgtgcttagaaggcaaatcttattaccattcagaaagccactgatc
attttcacaccaaagtctttactgaggctgcccgaggcacactccagtttcgatgagatg
atcacagggacaaaattcctaaggataattccagatggtggtcctgcatccaaacaccca
gaaaaagtcaaaagggtcatcttctgcaccggaaaagtgtactatgagctggcaaaagag
agaaaacagctgaagttggaggaggatgttgcaattgtcagattggagcagatatcaccc
ttcccttttgacctcatcaaggctgaggttgagaagtacagcaatgctgaactcatatgg
tgtcaagaggagcacaagaatatgggctactatgattacataaggccacgtttcctcaca
gtgcactctaagaatccaatatggtatgttggccgtgaccctgctgcagcccctgccaca
ggaaacaaattcactcatctggctgagctgaagaggttcttggacactgcgtttaacctc
gaggctttcaagggcaggagtttttga

DBGET integrated database retrieval system