KEGG   Sinocyclocheilus rhinocerous: 107708252Help
Entry
107708252         CDS       T04916                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107708252
   00051 Fructose and mannose metabolism
    107708252
   00052 Galactose metabolism
    107708252
   00500 Starch and sucrose metabolism
    107708252
   00520 Amino sugar and nucleotide sugar metabolism
    107708252
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107708252
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107708252
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107708252
Membrane trafficking [BR:srx04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107708252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 817 aa AA seqDB search
MENQIYAIPENIMRGSGTELFDHIAECLANFLEKLGIKDKKLPLGFTFSFPCQQTKLDES
FLVSWTKGFKASGVEGRDVVGLLRKAIKKRGDFDIDIVAVINDTVGTMMTCGYDDHHCEI
GLIVGTGTNACYMEEMRHLELVDGDEGRMCVNMEWGAFGDDGALDDIRTEFDREIDAGSL
NPGKQLFEKMISGMYMGELVRLILVKMAKDGLLFQGHTTPDLLTTGHFQTSFVSAIENKK
SSEGLLRAEQVLRGLGLDSSPEDCVAVQRVCQIVSTRAAHLSAHLCAAALAAVLRQIRDN
KATERLRTTVGVDGSVYKNHPQFARRLNKMVRLLVPDCDVRFLRSEDGSGKGAAMVTAVA
YRLAKQHAERQRILDSLRLDRDQLLEVKRRMEEEMKRGLAEKAHTTAAVKMLPTFVRATP
DGTERGDFLALDLGGTNFRVLLVRVRSGKRRSVEMHNKIYTIPQDITQGTGEELFDHIVH
CIADFLEYMGMKGASLPLGFTFSFPCHQTRLDQGILIKWTKGFKASGCEGEDVATLLKDA
IHRSEEFELDVVAVVNDTVGTMMTCGYEDPQCEVGLIVGTGTNACYMEEMSNVELVDGDE
GRMCVNMEWGAFGDRGELDDVCTEFDRAVDDQSTYPGKQRYEKMISGMYLGEIVRNVLLD
FTAKGLLFRGKLSERLKTRGIFETKFLSQIESDRLALRQVRSILQHLGLTSSTCDDSILV
KEVCSVVSKRAAQLCGAGLAAVVDKIRLNRDLEKLSITVGVDGTLYKLHPHFASIMRETL
RDLAPDCEVTLVQSEDGSGKGAALITAVACRLRDARK
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccagatctacgctattccagagaacatcatgaggggcagcgggacagagctc
ttcgatcacatcgctgaatgcttggctaatttccttgagaaactgggcatcaaagacaag
aagctgcctcttggctttaccttttcgtttccttgccagcagaccaagctagatgagagt
tttctggtgtcctggaccaaaggttttaaggcgagtggagtggaggggagagatgttgtg
ggcctgttgagaaaagccatcaagaagagaggggattttgacattgacattgtggctgtg
atcaatgacactgtcggcaccatgatgacctgcggctacgatgaccatcactgtgagatc
ggcctcatcgtcgggacgggcaccaatgcatgctacatggaggagatgcgtcacctggag
ctggtggatggagatgaagggcgcatgtgcgtgaacatggagtggggtgcgttcggcgac
gacggtgcattagacgacatccgcaccgaattcgaccgagagatcgacgctggctccctc
aaccctggaaaacagctgtttgagaagatgatcagtgggatgtatatgggtgagctggtc
agactgatcctggtgaagatggctaaagacggcctgctcttccagggacacaccactcca
gatctgctcaccactggccacttccagacctccttcgtctctgccatcgagaataaaaag
agcagcgagggtctgctgagagcggagcaggttttgagaggactggggctggactcgtct
ccggaggactgcgtggccgtacagagagtgtgtcagattgtctcgacacgagcagctcat
ctctcagctcatctctgtgccgccgcgctcgcagctgtcctgcggcagatccgggataac
aaagccacagagagactgcgcaccactgttggcgtggacggatcggtctacaagaaccac
ccacagtttgcccggcgactgaataagatggtgcggttattggtgccagactgcgatgtg
cgtttccttcgctcggaggacggcagcggtaaaggggcagcgatggtcactgctgtggcg
taccgattggcgaagcagcatgcagagcgccagcgtatcctcgacagcctccgcctcgat
cgagatcagctgctggaggtgaagagaaggatggaggaggagatgaagcgaggcttggct
gaaaaagcacacaccacggctgctgtcaaaatgctgcccacctttgtgcgcgccacgccg
gatggaacagagcgtggcgacttcttggcactggatctgggcggcacaaacttcagggtg
ctcttggtgcgtgttcgaagtgggaaaagacggagcgttgagatgcataataagatctac
accatccctcaagacattacccagggcaccggcgaggagttatttgatcacatagtgcac
tgcattgctgacttcctggagtatatgggtatgaagggagcatcgctgcctctgggattc
accttctcgtttccctgccatcagacccgactggatcagggaatcttgataaagtggaca
aagggcttcaaggcctcggggtgtgagggagaagatgtggccacgctactgaaagacgcc
atccatcgcagtgaggagtttgaactggatgtggtagcagtggtgaatgacaccgtgggc
accatgatgacttgtgggtacgaggatcctcaatgtgaagttgggcttattgtcggcaca
ggaactaatgcatgctacatggaggagatgtcaaacgttgagctggtggatggggatgaa
ggtcgtatgtgtgtgaacatggagtggggagcgtttggggaccgcggggagctggatgac
gtttgcacggagtttgatcgagccgtggatgaccagtccacttaccctgggaaacagcga
tatgagaagatgatcagcgggatgtatctcggagagatcgtcagaaacgtgctcttggac
ttcactgccaaaggcctgcttttccgtggcaaactttcagagagactgaaaacacgcggt
atcttcgaaaccaagttcctgtcgcagatcgagagcgatcgtttggcgctgaggcaggtg
cgctccatcctgcagcacctgggtttgaccagcagcacgtgtgatgacagtattctcgtg
aaggaggtttgcagtgtggtgtccaaacgtgcggcccagctgtgtggagccggtctggcg
gccgtggtggacaagatacgactgaaccgcgaccttgagaagctcagcatcactgttgga
gtggacggcacgctctacaaactccacccgcactttgccagcatcatgcgggaaacctta
agagacctggcccccgactgtgaggttactctcgtccaatcagaagatggcagcggaaaa
ggtgccgccctcatcacggccgtggcttgtcgattaagagacgctagaaagtag

DBGET integrated database retrieval system