KEGG   Sinocyclocheilus rhinocerous: 107709289Help
Entry
107709289         CDS       T04916                                 

Definition
(RefSeq) probable histone deacetylase 1-B isoform X1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    107709289
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    107709289
Enzymes [BR:srx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107709289
Chromosome [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107709289
   HDAC complexes
    Sin3A-HDAC complex
     107709289
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107709289
  Chromatin remodeling factors
   NuRD complex
    107709289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MALSSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
NAEEMTKYHSDDYIKFLFSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEDDPDKRISIRAHDKRIACDEEF
SDSEDEGQGGRRNAANYKKPKRVKTEEEKDGEEKKGEPTDVKEEEKASEEKMDTKGPKEE
LKTV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagttctcaaggaacaaagaagaaagtttgctattattatgacggggatgtt
gggaattactactatggccagggtcatcccatgaaaccccacagaatccgcatgacccac
aacctcctgctcaactatgggctgtataggaaaatggaaatttatcggcctcataaagcc
aatgctgaagaaatgacgaagtatcacagtgacgattacatcaagttcctcttttccatc
cgcccagacaacatgtctgagtacagcaagcagatgcagagatttaacgtaggggaggat
tgtcctgtctttgacggcttatttgagttctgtcagctctcaacaggtggatctgttgct
ggggctgtgaaactcaacaaacagcagacagacattgccattaactgggcaggaggcctt
catcatgccaagaaatctgaggcatctggattctgctatgtcaacgacattgtactcgcc
attctggagctgctcaagtaccatcaaagagtgctttacatcgacattgacattcatcac
ggggatggagttgaggaagctttctacacaacagaccgtgtcatgactgtgtccttccac
aagtatggagagtatttccctggtactggagacctcagagatattggtgcagggaaggga
aaatactatgcagtgaattacccactcagagatggtatagatgatgagtcatatgaagcc
atattcaaacctatcatggccaaagtgatggagatgtaccaacccagtgctgtggtgctc
cagtgtggcgctgactctctgtctggagatagattgggctgctttaacctcaccatcaaa
ggtcatgctaagtgtgtggagtacatgaagagctttaacctgcccctgctcatgctggga
ggtggaggctacaccatcaggaacgtggcccgctgctggacctatgagacggctgtagcg
ctggacagcactattcccaacgagctcccgtacaatgactattttgagtattttggacct
gatttcaagcttcacattagcccctccaacatgaccaatcagaatacaaatgactatctt
gaaaagatcaaacagcgtctgtttgagaatctgcggatgttgcctcatgccccaggggtt
cagatgcaggcgatcccagaggatgctgttcaggaagacagcggagatgaggaggacgac
cctgacaaacgcatctccatccgtgcccatgacaagcggatagcctgcgatgaggagttc
tcggactccgaggacgaaggacagggcggccggagaaatgcagctaattacaaaaagcct
aagcgagtgaagactgaagaagagaaggatggagaagagaagaaaggtgagccaacagat
gttaaagaagaagagaaagcttcagaagaaaaaatggacacaaaggggccaaaagaagag
ctaaaaacagtctga

DBGET integrated database retrieval system