KEGG   Sinocyclocheilus rhinocerous: 107715563Help
Entry
107715563         CDS       T04916                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00010  Glycolysis / Gluconeogenesis
srx00053  Ascorbate and aldarate metabolism
srx00071  Fatty acid degradation
srx00260  Glycine, serine and threonine metabolism
srx00280  Valine, leucine and isoleucine degradation
srx00310  Lysine degradation
srx00330  Arginine and proline metabolism
srx00340  Histidine metabolism
srx00380  Tryptophan metabolism
srx00410  beta-Alanine metabolism
srx00561  Glycerolipid metabolism
srx00620  Pyruvate metabolism
srx01100  Metabolic pathways
Module
srx_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
srx_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107715563 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    107715563 (aldh7a1)
   00620 Pyruvate metabolism
    107715563 (aldh7a1)
  Lipid metabolism
   00071 Fatty acid degradation
    107715563 (aldh7a1)
   00561 Glycerolipid metabolism
    107715563 (aldh7a1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107715563 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    107715563 (aldh7a1)
   00310 Lysine degradation
    107715563 (aldh7a1)
   00330 Arginine and proline metabolism
    107715563 (aldh7a1)
   00340 Histidine metabolism
    107715563 (aldh7a1)
   00380 Tryptophan metabolism
    107715563 (aldh7a1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107715563 (aldh7a1)
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107715563 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     107715563 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     107715563 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh TarH
Motif
Other DBs
NCBI-GeneID: 107715563
NCBI-ProteinID: XP_016377195
LinkDB All DBs
Position
Unknown
AA seq 552 aa AA seqDB search
MRVALGCVRQFTMQRVLTQRVARLFAVRIKLSPSVGAAAVNMSTLLVNRPQYSWLRELGL
SEDNDGVYNGSWGGQGQVVTSYCPANNEPIARVRPATMAEYEETVQKAQEAWKVWADVPA
PKRGEVVRQIGDALRGKIKALGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGP
ILPSERPGHALIEQWNPVGLVGVITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTPLTS
VAVTRIVAEVLERNHLPGAICSMTCGGADIGTAMAKDERVGLLSFTGSTQVGKQVAMMVQ
ERFGRQLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDDVV
ERIAKAYKQIRIGDPWDPSTLYGPLHTKQAVQQYLAAIEQAKQQGGTLVCGGKIMDRPGN
YVEPTIITGLPHDAPIVHTETFVPILYVLKFKTEDEAFAWNNEVKQGLSSSIFTKDMGRV
FRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYS
KDLPLAQGIKFE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggcgctcggctgcgtgcgtcagttcaccatgcagcgcgtgctgacgcagaga
gtggcgcggctcttcgctgtgaggattaaactgtcgccgagtgtcggagctgcggcggtg
aacatgtcgacgctgctcgttaaccggccgcagtacagctggctgagagagctgggcctg
agcgaggacaacgacggcgtgtataacggctcctggggcggccagggacaggtggtcact
tcatactgtccagccaacaatgagcccattgcccgagtgcgcccggcaaccatggcggaa
tatgaggaaactgtacagaaagcacaagaagcgtggaaagtgtgggcagatgttcctgct
ccaaagagaggtgaagtcgtccggcagatcggagacgctttaagagggaagatcaaagct
ctcggcagcttggtgtctctggagatgggcaagatctatgtggagggtgttggtgaggtg
caggagtatgtggacgtgtgtgactatgctgtgggactgtcccgtatgatcggcggaccc
attttaccctctgaaaggccgggtcacgcgctcatcgagcagtggaatcctgtgggtttg
gtaggagtcatcactgcctttaacttccccgtggctgtatacggctggaacaacgccatc
gctctcatctgcggcaacgtctgtctgtggaagggagcgccgacgacacccctcacgagc
gtcgctgtgaccaggattgtagcggaggtgctggagcgcaatcatcttcctggagcgatc
tgctctatgacctgcggaggtgctgacattggcacggccatggctaaagatgagcgagtg
ggtctgctgtccttcacaggcagcactcaagtgggcaaacaggtggccatgatggtacaa
gaacgattcggtcgtcagctgctggagttgggaggaaataatgccatcatagtgtttgag
gatgctgatcttaatctggttgtgccgtctgctgtctttgcctctgtgggaacggctggc
cagcgctgcactactaccagacgactgatgctgcatgaaagtgtacatgatgatgttgtg
gagaggatcgctaaagcttacaagcagatccgcattggtgacccctgggacccaagcact
ctttatggacctctgcacaccaaacaggctgttcagcagtatctggcggccatagagcaa
gcaaagcagcagggtggcactcttgtatgcgggggaaagattatggatcgcccgggtaac
tatgtggagcctaccattatcactggactgccacacgacgctcccatagtgcacacagag
accttcgtgcctatcctttacgtgcttaaattcaagaccgaggatgaagcatttgcctgg
aataatgaagtgaaacaagggctctccagcagcatcttcactaaagacatgggtcgagtg
ttccgctggttaggccccaaaggctctgactgtggcattgtgaacgtcaacattccaacc
agcggcgcagagatcggaggagcgtttggaggagagaaacacacaggaggcgggcgcgag
tcgggcagtgactcatggaagcagtacatgagaagatccacatgcactatcaactacagc
aaagatctgccattggcccaggggatcaagtttgaatga

DBGET integrated database retrieval system