KEGG   Sinocyclocheilus rhinocerous: 107723461Help
Entry
107723461         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B-like
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107723461
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107723461
Chromosome [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107723461
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107723461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1213 aa AA seqDB search
MEVDASLTSGMEMELDPELEEELGVSLDELRSWIEEQVDSSEAVRQRKDQLEQLQEWVEQ
REKEVADTDALCSNASESVVQCESLVKEVYSKMGLVYHESSSEDEGGGKANTSEVIEIDD
DDDDDVIAVGCVVPPKKVVTPSKDPAFKEASAALQRTSQQVQNLAQSVNRTAPSSLTPAK
AVAPPTQSHGALAVPAVFMSSGPRNAPTQPNPNLKQDNIKINMTLLGKKRTKTWHRGTLV
AIKQVGNNFKYKVKFENKGKSLLSGNHVAFDYHPTLERLFVGARVVARYKDGNQVWLYAG
VVAEMPNSKNRMRFLIFFDDGYASYVGLPELYPICRPLKKTWEDIEDASCRDFIEEYITS
YPNRPMVLLKPGQIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMF
NLKMNTASSQEKKMAGQQRQRPNMGALRTKGPVVQYTSENSTSASSRPAAPQIPPPRPMA
AGPPQPSRTESPSLKSQMAKKSTGSVALQPRQVMASDLQPKALIGTVHHTNTSRLFLLQS
GPVHTLTPIIQAPHNLQTTVSTYTSERIPQEPSYQAPNDRLFYLTHNCTPDCLKRIRPTH
PNLHRGRNPLLTPLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMAEIQHYLFQTHC
DFIFLEMFCLDPYVLVDRRFQPQRPFYFIRDITGGREDIPLSCVNEIDNTPPPSVAYSKE
RIPADGVFINTSSDFLVGCDCTDGCRDKSKCSCHQLTLQATGCAPGGQINPNAGYHNKRL
EECLPTGMYECNKRCRCNPQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVC
IYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRVK
LPASSQHGKSTTKMEERNSSTTGKSQDDSSEDSDDKDEESNEDESDSSDDTFVKDTYYST
SSVWRSYTTRRQAKGIKEESQDSKDGLSASTGEERKPPPMPEETGKSKVASWLTSQSSTS
ANQSVKVEGGIKTEKKDVMTLSDSDDVQTISSGSDDNKEREKKTQAVVKRQVAVKSTRGF
ALKSHSLMVKTGGGGAGGGGSGPSHGQGGGGGDSGPKNTRQFFDGEESCYIIDAKLEGNL
GRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELL
CCCGSTECRGRLL
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggatgccagtttgacctcaggaatggagatggagttggatccagagttggag
gaggagttaggggtgtctttggacgagctgcgcagttggatcgaggagcaggtggacagc
agcgaggccgtgaggcagaggaaagatcagctggagcagctgcaggaatgggttgagcag
agggagaaggaggttgctgatacagatgctctttgctctaatgcctcagagtctgtggtt
cagtgtgaatctctggtgaaggaagtgtacagtaagatgggtctggtgtatcatgagagc
agctcagaggatgagggaggaggcaaggcaaacacttctgaggtcattgagattgacgat
gatgatgacgacgatgttattgctgtgggatgtgtggttcctcccaagaaggttgtaact
cccagcaaggacccagcgtttaaggaggcttcagctgctcttcaacgaacatctcagcag
gtgcagaacctggcccagtctgtcaatagaacagccccctcgagtttaacaccagctaaa
gctgtggcccctcccacacaatcccatggtgctctagctgttccagcagtgtttatgtcc
tcaggcccaaggaacgcacccactcaaccaaaccctaatttaaaacaggataatatcaag
atcaacatgacactgttgggtaaaaaacgaaccaagacgtggcatcgtggaacacttgtt
gccatcaaacaagtggggaacaattttaagtacaaggtgaagtttgagaataaagggaag
agtcttctctctgggaaccacgtggcatttgattaccacccaacactggagaggctgttt
gttggtgcccgtgtcgtcgccaggtacaaggatggcaatcaagtctggctctatgcaggc
gtagtcgctgagatgcccaacagcaagaaccgtatgaggttcctgatctttttcgatgat
ggttatgcctcatatgtaggcctgcctgagctgtacccgatctgcagaccattaaaaaag
acctgggaggatattgaggatgcatcatgcagagatttcattgaggagtacatcacgtca
tatcccaacagacccatggtgctgctgaagccagggcaaatcataaagacggaatgggag
ggaacatggtggaaaagccgtgtggaagaagtggatggcagccttgtcaaaatgcttttc
ctggatgataagcggagtgagtggatttatcgtggctcaacaagactagaacccatgttt
aatctgaaaatgaacacagctagcagtcaagagaagaaaatggctggtcaacaaagacag
cgtcccaatatgggagcattgaggacaaagggccctgtagtccagtacactagtgaaaac
agtacttctgcttccagtcgacctgcagccccacagatcccaccacctcggccaatggct
gctggacccccacagccttcccgcacagagagtcctagtttaaagagtcaaatggctaaa
aagagcactggttccgttgcactgcagcctcgtcaggtcatggcctctgacctccagccc
aaagcactaatcggcactgttcaccacactaatacctccaggctctttcttctgcagtct
ggacctgtgcatacgttgacgccaatcatacaagctccgcataatttgcagacaactgtg
tcaacctacacaagtgagcgtattcctcaggagccatcgtaccaggctccgaatgacaga
ctcttctaccttacacacaactgcacacctgactgtctaaagcgcatccggcccacccat
cccaacctgcatcgaggacgcaacccacttcttactccattgctctacgagtttcgccgc
atgactggccgcagacgccttaaccgcaagatgtcattccatgtcatctacaagtccccg
tgtggcttgagtctgagaaatatggcagaaatccagcactacctcttccagacacactgt
gacttcatcttcttggagatgttctgtctggacccctatgtgctggtggatcgtcgattc
caaccccagaggccattctacttcatccgggacatcacaggcggtcgcgaagacattccc
ttgtcctgtgtgaatgagatcgacaacactcctccgcccagtgtggcctacagtaaagag
aggatcccagcagatggagtctttattaacaccagctcagacttcctggtgggctgtgac
tgcactgatggctgcagagacaaatccaagtgttcgtgtcatcagctgactctgcaggct
acagggtgtgcgccaggtgggcagatcaaccccaatgctggataccataacaagagactg
gaagagtgtctccctacagggatgtatgaatgtaataagcgctgccgctgtaatccgcag
atgtgcactaaccgtctggttcagcacggtttgcaggtccgactgcaactctttaagacc
caaaataaaggctggggcattcgttgccttgatgacgtcgccaagggctcatttgtttgt
atatatgcaggtaaaatcctgacagatgactttgccgataaagaaggtttggaaatgggt
gatgaatactttgccaatctagaccacattgagagcgtggagaactttaaggaaggttac
gagagtgaggcccactgctccgacagcgagggcagcggggtggacatgagcagggttaaa
ctacctgcttcctcccaacacggtaaatccaccaccaagatggaggagcgtaacagcagc
actaccggcaaaagtcaagacgattcatctgaagacagtgatgacaaagacgaagagtct
aatgaggatgagagtgacagctcagatgacacatttgtgaaagacacatattactccacc
agctcagtgtggaggagctacaccacccgcagacaagccaagggaattaaggaagagagt
caggacagtaaggatggactgagtgcatccacaggtgaagagaggaagccacctccaatg
ccagaggagaccgggaagagtaaagtggcatcttggctcaccagccagtcttccacttct
gcaaatcagagcgtcaaggtggagggagggataaagacggagaagaaggatgtaatgacc
ctctctgacagtgatgatgtgcagactatcagctcaggatcagatgacaacaaggagagg
gagaaaaagactcaagctgtggtgaagaggcaggtggcggtgaagtccacacgtggcttt
gctttgaagtcccacagtctgatggtgaaaacaggaggagggggggcaggaggaggtggc
tcaggcccatctcatggacagggaggtggcgggggcgacagtggccctaaaaacacccgc
cagttctttgatggggaagaatcctgttatatcattgatgccaaactagagggcaacctt
ggacgctacctcaatcatagctgcagccccaatctgttcgtccagaatgtgtttgtggat
actcatgatctccgcttcccatgggtggccttctttgctagcaagcgaatccgagcaggg
acggagctgacgtgggattataattatgaagttggcagcgtggagggcaaggagcttctg
tgctgctgtggatcaacagaatgcagaggacgactgctgtaa

DBGET integrated database retrieval system