KEGG   Sinocyclocheilus rhinocerous: 107723473Help
Entry
107723473         CDS       T04916                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107723473
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107723473
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107723473
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107723473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MRSLVFLVLLGAAFALDDDKIVGGYECTPYSQPWQVSLNSGYHFCGGSLVSEYWVVSAAH
CYKSQVEVHLGEHNIVVDEGSEQFISSEKVIRHPNYDSWTIDSDIMLIKLSNPANLNQYV
QPVALPNGCAAAGTMCSVTGWGNTMSSTADPNKLQCLEIPILSDSDCNNSYPGMITDTMF
CAGYLEGGKDSCQGDSGGPVVCNNVLQGIVSWGYGCAEKNHPGVYGKVCVFSQWIADTMN
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttggtgttcctggtgctccttggagctgcctttgctctggatgatgacaag
attgttggtggatatgagtgcacaccctattcccagccctggcaggtgtctctgaactct
ggctaccacttttgtggtggctctctggtcagcgagtactgggttgtgtctgctgctcac
tgctacaagtcacaagtggaggtccatttgggtgagcacaacatcgtagttgatgagggt
tctgagcagttcatctcctctgagaaggtcatccgccatcccaactatgactcctggaca
attgacagtgacatcatgctgatcaagcttagcaatcccgctaacctcaatcagtatgtg
cagcctgtggccctgcccaatggctgtgccgccgctggcaccatgtgcagtgtcactggc
tggggaaacaccatgagttccactgctgatcccaacaagcttcagtgtctggagatcccc
atcctgtccgacagcgactgcaacaactcctaccctggtatgatcacagataccatgttc
tgtgctggatacctggagggaggaaaggactcttgtcagggtgactctggtggtcctgtg
gtgtgcaacaatgtgctgcagggtattgtgtcctggggttatggctgtgctgagaagaat
catcctggtgtctatggcaaggtctgtgtgttcagccaatggatcgccgacaccatgaat
agcaactaa

DBGET integrated database retrieval system