KEGG   Sinocyclocheilus rhinocerous: 107728563Help
Entry
107728563         CDS       T04916                                 

Definition
(RefSeq) DNA-directed RNA polymerase, mitochondrial-like
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     107728563
Mitochondrial biogenesis [BR:srx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    107728563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_2 PPR_3
Motif
Other DBs
NCBI-GeneID: 107728563
NCBI-ProteinID: XP_016394260
LinkDB All DBs
Position
Unknown
AA seq 1332 aa AA seqDB search
MSLLRLCAYSAALTRSFAVDRSVQRFLNGDYCHLCLRIRSNGERQIQEKTWATIYQRHYS
AIPKKEGGKKRFCEQSQLLDVLEARIQQLQSDAVVDVKHSKVQIIKMQQKIQKTSPGNSQ
KNLPGEKAEMLKSGPSAKKGGTEGVVPSKTHASRWMEKLKREKWINPKKQTSHRMHDKTV
VGKNSKGSSMRPGTSTKTITTGKRSETKTKGEDSKTSASTTTSSKISAVQKKSKKKVSRV
SESLAVRFPGVQKISSSEVDCVSEMSTQEKLADKEFDEVEEIDVDIEIDQQSSSAPERLL
EDKEGNRYGDPQLRIRCYLEACVFIDDVARAQSCLLSHHRQLSKRMHLSISAYNIVMRMW
AKRGSFSHIRRLFVLIEEAGLKPNVASYSAALECMGRMPECQTWIIKRCLQQMEVDGLSV
DDVFRQCVFKKDEREMVLRAVRLVHPEYQPSVSKDQPVCSLPLVKQFYAEREGATYPKLD
FSLKELRDCFSLQLGMEKATTITIDSVEALKPVTENMAKMRELLATQRKHWEKALLQTLK
EKKRIVSSNSQKSWSTCIYPYLCILDDQDYVNIMLQGLNKLSPSGESLLIMAEEMGNRVY
NLYSIRQKSHSQMIEKLGSIYNSYSELLANDTETNGMLPRECWASLEMQRCSGPSLLSDD
TPWPMVLMVQLGSFLVDLMVRELKIWSNILNPAQEKKLIPVLYHMYTFRSNHKIGFIKPH
PIVTQIQRVAMETKLTFDSYVMPMLCPPVPWTSPKSGAYLLTPTKLMRSTDGAIQHQLLL
EKSRDEDLHAVLDSLNQVGSCPWKINKPLLDIIISIFNDKGNDKLCIPPPLSEAPEVPRF
NHHDPSYTQAEKAYMKREGVKAKKKVAEMHSLRMDALYKLSIANHMRDEIFWFPHNMDFR
GRTYPRPPYFNHLGSDVTRGVLLFAEGQPLGPKGLDWLKIHLVNLTGLKKCSSLAGRLEY
ADSIMEDILDSADHPLDGRKWWMNADEPWQALACCMEIANASRSPDHTKFISYFPVHQDG
SCNGLQHYAALGRDVIGATSVNLMPCELPQDVYSGVAQQVEEFRARDAEKGLKIAQVLEG
FISRKVVKQTVMTVVYGVTRYGGRLQIEKRLKEIDDFPKDYIWDASHYLVKQVFSSLKEM
FTGTREIQEWLTESASLIAKSGRTVEWVTPLGLPIVQPYHRIKNQTLKSSMQNLSIHISH
DANEKPDSMKQKNAFPPNFIHSLDSTHMMLTSLHCYRAGLTFVSVHDCYWTHAVTVDIMN
RMCREQFVALHSQPILKELSGFLLKKYCSRPPVVSKPKKFEEHFKMAQLLASVPQTGDFD
LEKVKESVYFFS
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttttgagactgtgtgcctattcagctgctttaactcgcagttttgcggttgac
agaagtgttcagagatttctgaatggcgattattgccacctgtgtctcagaatacggagt
aatggagagagacaaatacaagagaaaacatgggctacaatttaccaaagacactattca
gccatccctaagaaggaaggtgggaagaaaagattctgtgaacagtctcagctgttggat
gtcctggaggccagaatccaacagctgcaatctgacgccgttgtagacgtcaaacattca
aaggtgcaaatcatcaaaatgcagcagaaaatacagaaaacatcacctgggaatagtcaa
aagaacttgccaggagaaaaagcagaaatgcttaaaagtgggccctctgcaaaaaaaggt
ggaactgaaggcgtcgtgccttccaaaactcacgcaagtcgctggatggagaaactcaag
cgtgaaaagtggatcaatcccaaaaaacaaacttcacatagaatgcacgacaagacagtt
gtgggtaaaaacagcaaagggagttcaatgcgtcctggtacatctacaaagaccatcaca
acaggcaaaagaagtgagacaaaaactaaaggagaagactccaaaacctctgcgtctacc
acgacatcctccaaaatcagtgctgtgcaaaaaaagtctaaaaagaaggtttcgagagtc
tcagaaagtttagccgtcaggtttccaggagtgcaaaagatctccagcagtgaagttgac
tgtgtttctgagatgtctacacaagagaagctggcagataaagaatttgatgaggtagag
gagattgatgtagacatcgaaatcgaccagcagagctcgagtgctcctgaaaggcttctg
gaggataaggaaggaaaccgctatggagatcctcagctcagaatccgctgttacttggag
gcgtgtgttttcatcgatgatgtagctagagctcagagctgcctactttctcatcatcgt
caattatccaaacgaatgcacctgtctatcagcgcctacaacatcgtgatgaggatgtgg
gccaaaagaggttccttcagtcacattcgtcgcttgttcgttctgattgaagaagcaggt
ctgaaacccaacgttgcgtcttacagtgctgctctggagtgcatgggccgcatgcctgag
tgtcagacatggatcattaaaaggtgtctgcagcagatggaagtggacggcctgtccgtg
gatgacgtgttcagacagtgtgtgtttaaaaaggatgaaagagaaatggttctgagggcc
gtccgtttggtgcatcctgaataccaacccagtgtatccaaagatcagcctgtctgttcc
ctgccattggtgaaacagttttatgctgagagagaaggtgccacatatcctaaactggac
ttcagcctgaaagaactgcgtgactgcttcagtcttcagctgggtatggagaaggccact
accatcactattgactccgtggaggccttaaagcctgtcaccgaaaatatggccaaaatg
agagaattactagcaacacagcgcaaacactgggagaaagctctcctccagacactgaag
gaaaagaaacggatagtatccagcaacagccagaagtcctggagtacctgcatataccca
tacctgtgtatcctggatgatcaggattatgtgaacatcatgcttcagggtttaaacaaa
ctgtcacccagcggtgaatctttgcttatcatggcggaggagatgggaaaccgtgtctac
aatttgtactccatccggcagaagagccacagtcagatgatcgagaagcttgggagtatc
tacaactcgtattctgagctcctggcgaatgacactgagaccaatggcatgctgccacgg
gagtgttgggcgagtcttgagatgcagaggtgcagcggtccctctcttttaagtgatgac
accccttggccgatggttctgatggtgcagctgggcagcttcctggttgacctgatggtt
cgtgagctcaaaatttggagcaacatcctcaatcccgctcaagagaagaagctcatccct
gtcctttaccacatgtacacgttccgcagcaatcataagattggcttcatcaaaccgcat
cctattgtgacacaaatccagagggttgcgatggaaaccaaacttacgtttgactcctac
gtcatgcccatgctgtgtccgcccgttccctggacgtccccgaagagtggcgcttacctg
ttgacgccaaccaagctgatgcgctccaccgatggagccatccaacaccaacttctcctg
gagaagagccgagatgaggatctccatgctgtgctggactctctcaatcaggtgggcagc
tgcccttggaagatcaacaagcccctgttggacatcatcatctcgatcttcaacgacaaa
ggcaacgacaagctctgcatccctccgccactgtccgaagcacccgaggttcctcgcttc
aaccatcacgacccgtcctacactcaggccgagaaggcctacatgaaacgggagggtgtc
aaagccaagaagaaggtagcggagatgcacagcctccgaatggacgcgctgtataagttg
tccatcgccaaccacatgagggacgagatcttttggtttccacacaatatggacttccga
gggcgtacgtacccccggccgccttattttaaccaccttggtagtgacgtgaccagggga
gtgctgctgttcgccgagggacaacctctcgggcccaaaggcctcgactggttgaagatc
cacctggtgaacctcacagggttgaagaaatgtagctcactagctggacgactagagtat
gctgatagtatcatggaggacatcctagactcggcagaccatcctcttgacggtcgcaaa
tggtggatgaatgcagatgagccgtggcaggcgctggcttgctgtatggagatagcaaat
gcctcccgctcccccgaccacaccaaattcatctcttatttccctgttcatcaggacggg
tcgtgcaacggcctccagcactatgctgccctcgggcgggatgtgattggtgctacttcg
gtgaacctcatgccctgtgaactgcctcaggatgtgtacagcggtgtagctcagcaggtg
gaagagttcagggctcgggatgcggagaagggtttgaagatcgcgcaggtgctggagggc
ttcatcagcaggaaggtggtgaagcagacggtgatgactgtggtctatggcgtcacgcgc
tacgggggccgtctgcaaatcgaaaagcgactgaaggaaatcgatgatttccctaaggac
tacatatgggatgcttcacattacctggtgaagcaggtgttcagcagcttgaaggaaatg
ttcacagggacgagagaaattcaggaatggctgacggagagcgcaagtctaatagctaag
tctgggaggacggtggaatgggtcacgccactgggacttcctatcgttcagccctaccac
cgaataaagaaccaaacgctcaagagcagcatgcagaacctgagcatccatataagtcat
gatgccaatgagaaaccagacagcatgaagcagaaaaacgccttccctcctaattttatc
cactctctggactccactcacatgatgctgacatcactgcattgttacagggctggtctg
acgtttgtgtccgtccatgactgttattggacccatgctgtgacggtggacatcatgaac
aggatgtgtcgtgagcagtttgtggctctgcacagtcagcccattctaaaggagctgtcc
gggtttcttctaaagaaatattgcagcaggccaccggttgtatccaagccaaagaagttt
gaagagcactttaagatggcacagcttttggccagtgttcctcaaacaggtgatttcgac
ctggaaaaagtgaaagaatcagtgtatttcttcagctga

DBGET integrated database retrieval system