KEGG   Sinocyclocheilus rhinocerous: 107729457Help
Entry
107729457         CDS       T04916                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1A-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107729457
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107729457
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107729457
   HMT complexes
    COMPASS/SET1 complex
     107729457
    COMPASS/SET1 complex (yeast)
     107729457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 107729457
NCBI-ProteinID: XP_016395450
LinkDB All DBs
Position
Unknown
AA seq 2174 aa AA seqDB search
MDPDSGADTQQTLSLQWKSYKLVQDPALRRVTQKIYRYDGIHFNVQDSGFPPVGDLRDPR
PRRIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLI
VSGSYTPQTVPTGGKALTEKFQPPAPTQPDTSSDIRRRLSTDQMAAPAAPLNSGSTTPCS
VDTGFGDQRLDTPPSSLGGAYTPGSSASSQGGGTPHTPRSGTPFSQDSGFSVGRHSGYSS
TQSYPQQDMLPSSSCSSSAVSSSSGFKPPRFHDDLHAPPPQEPSVFHRGRPGYPPSASFR
PNEPPYPYPSVGGSGMQMPLHPPMPPPGPQFEPPPLSDRDRDRDRERGHRDRDRERDSGG
HYGGGISSRRSSYHYQQETNSSSTSKSYHSHHSHHADRREDRDGRGYRRDSSGSRSGDHG
RHRNHHHSHNHHSSGGGGSSRRRGSRDREWERDREGDYNISDPRYGGHSDSSHNSSNSLS
PPSATSSYGGPKDLSPYDTPSSSRLEPSPAFRPQQGAGERGFGMGGSMDNDYRAHSHLTP
LAPPPPPLPPASVIAAAVAETLGSLDFGQDSPIPEEQWTKPKRYPSTPPHPPQTPPTSSP
PHASIPSSSTSPSSTSLPHHLPSSTASLSPPPPQRDSSPEPDSTNESLPFMHHSSSLDSR
IEMLLKEQKAKFSFLASDDEDDEKEEDRERGKTGENADDGGKKLREENGERPSHKRQGET
EGGQQRRRGEKDGRRSRGKRQGGGVSEGRKTPPEVASSTPTTHSLVSESLQGQMPPPQEE
HTTSDLHGAPHTPPTYNGEAQPSPHSSGEDMEISDEDDNAITTTPHPAASSSASPHPEYP
PPLPHHMYDYASSIELMSQYCGGAPMSFQMQTHMLSRLHQMRMASSNSSTAPPGEVPPAS
EYPPSFHLHSIPPPPHHPHHTYMDQDGNVATHYDQDHRYIPPHLPYAYPDPHAAQLPQHH
TIPPPHSPWPPHLLPQQFPSHYPPPGFGTVPGIDGELYGAVGDQMAIMGHNPYEAVVQQV
LAALIEEMKNIMQRDLNRKMVENVAFGTFDEWWDRKEQKAKPFQTAMRGVAVVREEDKKD
EKTSNRPREPLMSLVDWAKSGGMEGFSLRGALRLPSFKVKRKEPQELVEGGELKRARPST
PPDEEDEDSYQGKSADTAAGRTEERRVADRRAARRRSRAKARKPYDLDSEGEETSDGSSS
EKEEDEDSDKVDESEDVALSADSDDESISSSSSESSSSSSSASSSSSDEEDEEDGEQAAE
SESLDTMDESTMDSVAAIDAEKDDGDKASLDQSSVTAAEVKQEEEKTATAVPPSSPYPRP
SSPFLLLPPLKKRRKTVSFSMEEREVKPSILSPSAPSPSPTPVSQASDVPTSSSPVSTPT
AAAPATSSKPAPMLLPFASRPSESNALTSPASPSTVLTIPPPVRSLRPDEPKKSPGLPPS
PQTPTAKNSSKRGKDSPRTPPAPICLTVQNLPLDHACLVKVAYEDPVPTPTTQKGRARGR
PRTLSQSASAPHLHPALEEEDEEELEQRLKLREQLGVSSLLQLASAPKPDLSVLADVALK
MDPEADIDSEETETSDEAEEHKLEEEEGDFFAPHPRQPLPDPEGLFVLQEHNYSKTPAHP
HLTSSQKRTKQDPTVLLPADLNQHGVQEAPEEVIGDALAARGEAPELYGDLSGMGLLCDA
RDTAETQTKTLGPPHKRRGPISKEMEMEERGKGKSKKRSRKDKENEELQISKKQKEKQRK
RKLEEYEEDVDVEQLESGELSSSSSDSGDSYFGLKRSLEFEKEEVRKSERLFLQEAGLTP
STQRRPKHVPTLAPLPQPSYKNRSEFEQMTILYDIWNTGLDQEDMRLLKSTYEKLLQVDR
GTDWLNDTHWVPHTITNIPNPRRKKKTADGQLREHVTGCARSEGYYAISRKEKDVYLELD
QPVTVQEAGEYDTSGSNRLLSERRSEQRRLLSAIGTPAVMDSDLLKLNQLKFRKKKLRFG
RSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRYAQEGIGSSYLFRVDHDTII
DATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPIEENKI
PCLCGTENCRGTLN
NT seq 6525 nt NT seq  +upstreamnt  +downstreamnt
atggatccggacagtggggcggacactcagcaaactctcagtctacaatggaagagctat
aagctagtacaagaccctgctctccgacgggttactcagaaaatctacagatatgatggg
attcactttaatgtacaggattcaggattcccgcctgtgggggacttgcgtgatccaaga
ccccgcagaatctggtctagacacacagagctgtcgctgccagtgcccaaatttaagttg
gacgagtattacgtaggtcctataccacttaaggaagtgacgtttgcgaggttgaatgat
aacatcaaagagccgttcctggcagagatgtgcgccaagtttggtgaggttgaggaaatg
gagattctgtttcatcccaagactcggaagcacttgggcttggcccgcgtcctcttcacc
agcactagaggggccaaagacaccgtcaaacacctgcacaatacttctgtcatgggaaac
attgtccatgtccagctagatatcaaaggccaacagaggatgaagtactatgacttaata
gtgagtggctcatacacccctcagacagtgcctactggaggcaaagcccttaccgagaaa
tttcagcccccagccccgactcagccagatacgtcgtctgatatccggcggaggctctcc
acagatcagatggcagctcctgctgcgcctctaaactctggcagcaccaccccctgttct
gtggacactggatttggagaccagcgcctagacacccctccatcctctctgggaggagct
tatacgccgggttcttctgcttcttcacagggcggcggcacccctcacacccctcgctct
ggaacccctttctcccaagactctggattctctgtgggcaggcacagtggctacagcagc
actcaaagttatccccagcaggatatgcttccatcttcctcctgctcctcttcagcagtc
tcctcatcatcagggtttaagccccctcgctttcatgacgacttacacgctccacctccg
caagaaccctccgtgttccacaggggtcggccgggatatcctccttcagcgtccttcaga
cctaatgaacctccctatccgtatcccagtgttggaggttcaggaatgcaaatgccgctg
catccacccatgccacctccagggcctcagtttgagccgccaccgctgtccgacagagat
cgagaccgagatagagaaaggggacacagggatagggatcgggagagagactcaggaggg
cactatggaggtgggataagctcccgacgttcctcttaccactaccaacaggaaacaaac
tcctcgtccacatccaaatcctaccattcacatcactcgcatcatgcagatcggcgggag
gacagggacggcaggggctaccggcgcgacagctcaggctcccgctcgggagatcatgga
aggcatcggaaccaccatcactcccacaaccaccacagcagcggcggaggtggatcgagc
cggcggagaggcagcagagaccgggaatgggagcgagacagagaaggagactataacatc
tccgatccacgttatggaggccactctgactccagccacaactcgtccaatagcctctcc
cctccctctgccacctcctcttatggaggacctaaagacctgtccccctacgacacacct
tcttcctcccggttagagccctcgccggctttccgtcctcagcagggtgcaggcgagagg
ggttttgggatgggaggaagtatggacaatgactaccgtgctcattctcacctcacgccc
ctggcgccgccacctcctcccctcccaccagcctccgtcatcgcagccgctgtggctgaa
acgctcggctctcttgattttggtcaggacagtcccatcccagaagaacagtggaccaaa
cccaaacgctatcccagcaccccgccccatccacctcagacacctccgacctcctcgcct
cctcatgcctcaatcccgtcatcctccacctctccatcctccacctccctgcctcaccac
ctcccctcttcgacagcatccctctctccgcctcctccacagcgtgactcctccccggag
cctgactccaccaatgagagcctgccattcatgcaccacagcagcagcttggactcacgt
attgagatgttgctgaaggaacaaaaagccaagttttctttccttgcctcagatgatgag
gacgatgagaaggaggaggaccgagagaggggtaaaacaggcgagaatgcagatgatggg
ggaaagaaactcagagaggagaacggtgaaaggcctagtcataagagacaaggagagacg
gagggaggccagcagaggaggagaggagagaaagatggacgccgcagcaggggcaaaagg
caaggtggtggagtcagtgaaggcaggaaaacacctccagaggtggcctcttccactccc
actacgcacagtttggtgtcagagtctcttcagggccaaatgccgccacctcaggaggag
cacacaacctctgacttacacggggctccacacaccccacccacctacaatggagaggca
cagccttctcctcactcttctggggaggatatggaaatatcagatgaagatgacaacgcc
atcaccacgaccccccatcctgctgcctcttcatccgcctcacctcacccagagtaccct
cctccgctgccgcatcacatgtacgactacgccagctccatagagctcatgagccagtac
tgtggaggagcacccatgtcattccagatgcagacacacatgctcagtcgcctccaccag
atgcgaatggcctcctccaacagctctacggcaccccctggagaagtcccgcccgcctct
gaatatcccccgtcatttcacctccattcgataccccctccaccgcaccacccacaccac
acatatatggaccaagatgggaatgttgccacccactatgaccaggaccaccgctacatc
cctcctcacttaccatatgcctacccggaccctcatgccgcacagcttccgcagcatcac
accatcccacctccccacagcccctggcctcctcacctgctaccccagcagtttccttcc
cactatcctccacctggcttcggcacagtgcctggcatagatggagagctgtacggagcg
gtgggtgaccagatggccataatgggccacaacccctacgaggccgtagtgcagcaggta
ctggcagctttgatcgaggagatgaagaacatcatgcagagggacctgaaccgcaagatg
gtggagaacgtcgcctttggcaccttcgacgaatggtgggaccgcaaggaacagaaagcc
aagccattccagacagccatgcggggagttgcagtggtgcgtgaggaggacaagaaggac
gagaagaccagcaaccgacctcgggagccactcatgtctctggtagactgggccaagagt
ggaggcatggagggtttctccctgcggggggccttgcgtttgccttcttttaaggtgaag
aggaaggagcctcaggaacttgtggagggtggtgagctgaagagagccaggccttccact
ccacccgatgaggaagatgaggactcgtatcagggcaaatctgccgacactgctgcagga
agaacagaagagaggcgtgtggcagacagaagagcagccaggagaagaagcagagcaaag
gcacgcaaaccatatgacctggacagtgagggagaagaaacatcagatggttcctcctcg
gagaaggaggaggatgaagacagtgacaaagtggatgagtcagaagatgtagcccttagt
gcagacagtgatgatgaaagcatttcttcctcctcttctgagagctcatcatcatcatcc
tccgcatcatcctcttcctccgatgaggaggatgaagaggacggtgaacaggccgctgag
agtgaatcattggacacaatggatgagtctacgatggacagtgtggcggctatagatgca
gaaaaggatgatggggacaaagcaagtcttgaccaatcatcagtgactgctgcagaggtc
aaacaagaagaagagaaaacggctacagctgtgcctccatcttctccgtatccccgtcct
tcttcaccctttctcctccttcccccactcaagaaacggcgcaagactgtttctttctcg
atggaagagagggaggtcaagccctccattctgtcaccttctgctccctctccatctccc
actcctgtctcacaagcttcagatgttcctacttcctcttctcccgtaagcacgcccaca
gcagctgccccagccacctcctccaagcccgccccgatgctccttccgtttgcttctcgt
cctagcgagagtaacgccctgacctcccctgcttccccttccaccgttcttaccatccct
ccaccggtgcgttccctgcggcctgatgagcccaaaaagagtccaggtctccctccatcc
ccacaaactcccacagccaaaaactcctccaaacgtggcaaagactctcccagaacgccc
ccggcgcccatctgcctcactgtccagaaccttccactggaccatgcctgcttagtcaaa
gtggcctatgaggaccccgtccctactccaaccacgcagaagggtcgtgcacgtggtcgc
cctcggacactcagccagtcggcttccgcccctcacctgcatcccgctctggaggaggag
gatgaagaggagctggagcagcggctgaaactcagggagcagctgggagtgtccagcctg
ctgcagctagcctctgcccccaagcctgacctgtctgtgctggccgatgtggcgctgaag
atggacccggaggcagatattgactcggaagaaaccgagacctccgatgaggcagaggag
cacaagctggaggaagaagagggagacttcttcgccccgcacccacgccaaccactcccg
gatccagagggtctgttcgtcctgcaggagcacaactattctaaaactcctgctcatccg
cacctcacgtcttcacaaaagaggacgaaacaggaccccacggtccttctccctgccgac
ctcaaccagcacggtgttcaggaagcccccgaagaggtcatcggggatgctctagccgca
agaggtgaggctccagagctatacggggacctttccgggatgggcctgctgtgcgacgcc
agggacacggctgagacacagaccaagaccctcggcccaccgcacaaaaggagaggaccg
attagcaaagagatggagatggaagagagggggaaagggaagagcaagaagagaagtagg
aaggacaaagaaaacgaggaactgcaaatctctaagaaacagaaggagaaacagaggaaa
cggaagttagaggaatatgaagaagacgtggatgtggaacagttggagtctggtgagctt
tccagctccagctctgactcgggagactcttactttggtctgaagagatcgctggagttt
gaaaaggaagaggttcgaaagagcgaacgacttttcctgcaggaagctggcttgacccct
tcgactcagcgacggcccaaacacgtgcccaccctagctcccttaccacagccctcttac
aagaaccgtagtgagtttgagcagatgaccatcctgtatgacatctggaacactggcctg
gaccaggaagatatgaggctcctgaagagcacctacgagaaactgttgcaagttgatcgc
ggcaccgactggctcaacgacacacactgggtccctcataccatcaccaacatccccaac
cctcgacggaagaagaagaccgcagatgggcagctaagagagcatgtcacgggctgtgct
cgtagtgaaggctactatgccatcagccgcaaggagaaagacgtctaccttgagctagac
cagccagtgactgtgcaggaagctggggaatatgacacctcaggctcgaatcgtctgctc
tctgaaaggcgctctgagcagcggcgtctcctcagcgctatcggcactccagcagtgatg
gactcagacctgttgaaactgaaccagctgaagttccgtaagaagaagctgaggtttggc
cgcagccgtatccacgaatggggcctgtttgccatggaacccattgctgcagatgagatg
gtcattgaatatgtgggacagagtatcagacagatggttgctgataatcgggagaagcga
tatgcccaagaaggcatcgggagcagctacctgttccgtgtcgatcatgacactatcatt
gacgccaccaagtgtggcaacttggctcggtttattaaccactgctgcacgcccaactgc
tacgccaaagtgatcaccatcgagtcccagaagaagatagtcatatactcaaagcagcct
atcggtgtgaacgaggagatcacgtatgattacaagttccccattgaagagaacaaaatc
ccatgtctgtgtggcacggagaactgcagaggaaccctcaactaa

DBGET integrated database retrieval system