KEGG   Sinocyclocheilus rhinocerous: 107738677Help
Entry
107738677         CDS       T04916                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107738677
Enzymes [BR:srx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107738677
Chromosome [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107738677
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 809 aa AA seqDB search
MGESKNMVLNGRRHGSKFSSNQPVSKSRLQNTQRAHLRQSKGSPSARRCSRRCGGAPPEA
ERRHVPSSGMTAKELCEYDDLSTSLILDPYLGFQTHKMNTRFRPIKGRQAELREVIELFK
KHDNLEKAFQALTAGDWTRHHFLNKTKSQEKLFKAHVFVYLRMFASDSGFEILPCNRYSS
EQNGAKIVATKDWKRNDKIEHLVGCIAELSPSEERMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKAGLPVETPVINSKYGLRETDKRLNRLKKLGESCRNSDSQSVSSNAEADSQ
EPTTVQTSLRKRTSQSCVKKHGEAKTITRQTLSSTPSSTSSSKRSQTNISSLPKRLNSKP
TQPLPKGRRRCRGVWTKCSRVSASGNLKEPSRRDADRRSSGGKGSVARLSENNQSSSKGA
SSCKDSILCPYRTRRSTRTSLGAQGADGTQASSQPSSPGVVLKAEPGELIPVTPGHQMNT
PSLETSCPKKGTCPRRRRTIKQEESGSYGESFLQEGVPDLRHAVRAADVADCGKVVLGLP
DHHQHYNGSAKSSKALRRGKGKKKRQITRYDAQLILQNNSGIPKITLRRRRDSSSSKNEA
REANSSSSSKISIKFSKEHEKDRSSSYIAKLNNGFSHGPHSSSTKLKIQLKREEDGAGLH
CTYPEDVTLGIVKREAGDVLDHKAGAQVGQSMEVESLSSEDEEEDYFDNEDDFIPLPPAK
RLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggcaggagacatggcagcaagttctccagt
aatcagcccgtaagcaagtccaggctgcaaaacacacagagagcccatcttcgtcaaagc
aagggctccccaagtgctagaagatgcagtcgacgttgtggtggggcgcccccggaggca
gaaaggcgccatgtcccctcatcgggaatgactgccaaggagctgtgtgagtatgatgat
ctgagcaccagtttgatcctggatccttaccttggcttccagacccacaagatgaacacc
aggtttcgaccaattaaaggtcggcaagcggagctgagggaagtgatcgagctttttaag
aagcatgacaacctggaaaaagcttttcaggctttgactgctggcgactggacgagacat
cactttctcaacaagaccaagtcccaagaaaagctcttcaaagcgcatgtgtttgtttac
ctacgcatgtttgcttcagacagcggctttgagatccttccttgcaatcgctactcctct
gagcaaaacggagccaaaattgtagcaacaaaagattggaagaggaatgataaaattgaa
catcttgtgggctgcattgctgagctgtctcccagtgaagagaggatgttgcttcgacat
ggagagaatgattttagtgtcatgtactctacacgcaaaaactgcgcgcaactctggctt
ggacctgcggcttttattaaccatgattgccggccaaattgcaagtttgtgtcaacaggc
cgagacaccgcctgtgtgaaggttttgcgggacattgaaccgggggaggagatctcctgt
tactatggagatggattctttggagaaaacaatgaattctgtgaatgctatacttgtgaa
agacgcggaactggagctttcaagtcgaaagcagggttgcctgtggagactccggtgatc
aatagcaagtatggccttcgagagacagacaagcgtctgaacagactgaagaagctgggg
gaaagttgcaggaactctgacagccagtctgtcagctccaatgcagaggcagactctcag
gaaccaaccactgtacaaacatcattacgtaagaggacttcacagtcctgtgtcaaaaag
cacggagaagctaaaactataacaaggcaaactctgtcaagcactccttcttctacctca
tcctctaaacgaagtcaaacgaatatttcaagtttaccaaagagacttaattcaaagccc
acacagcctttgcctaaaggaagacgacggtgtcgaggcgtatggacgaaatgtagccga
gtgagtgctagtgggaatctcaaggagccctccagacgagacgcagacagacgcagctcc
ggaggcaaaggcagtgtagcgcgcctatcagaaaacaatcagagctcttcgaagggtgct
tcctcatgcaaggacagcatactttgcccttacagaactcgtaggtccacgaggacctct
ctcggtgctcaaggggctgatggcacgcaggcatctagtcagccgtctagcccaggtgta
gtcctcaaggcggagcctggagagctcatccccgtgacaccagggcaccagatgaacacc
cctagtttggagacaagctgtccaaagaaagggacgtgtcccagacgaaggaggacgata
aaacaggaagagtccggctcctacggcgagtccttcctccaggagggcgtgcctgacctg
cggcacgcggttcgggctgcagatgtagcagattgtgggaaggtggtactcggcctgccg
gaccaccaccagcactacaacggctcggctaaaagcagcaaggccctgcgccgaggcaag
ggcaagaagaagcggcagatcacacgctacgacgctcagctgattctgcagaacaactca
ggcattcccaagataacactacgccggcgtcgagacagcagcagcagtaagaacgaggcc
agagaggccaattcctccagctcctcaaaaatcagcatcaagttcagcaaagagcacgag
aaggaccggagcagctcgtacatagccaagctgaacaacggcttcagccacggcccccac
agcagctccaccaagctcaagatccagctgaagcgggaggaagacggcgcggggttgcat
tgcacttacccggaggacgtcaccttaggcatcgtgaagcgagaagcgggggatgttctg
gatcacaaggcgggcgctcaggtaggtcagagcatggaagtggaatcgctgtcctctgag
gacgaagaagaggactactttgataacgaggatgatttcatcccgctcccaccagcaaaa
cgtctgcgtctcatcgtgggcaaagattccatagacattgacatttcctccagacgacga
gaagatcagtccctcagactcaatgcataa

DBGET integrated database retrieval system