KEGG   Sinocyclocheilus rhinocerous: 107739678Help
Entry
107739678         CDS       T04916                                 

Definition
(RefSeq) neuroendocrine convertase 1-like isoform X1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     107739678
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S8: subtilisin family
   107739678
Chaperones and folding catalysts [BR:srx03110]
 Intramolecular chaperones
  Subtilisin family
   107739678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 768 aa AA seqDB search
MEERCRPMLLCSILALFCALVSSAVDRQYLNEWAVEIPGGYDNARSIADELGYKLVRQIG
ALENHYLFKRHSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRAKRAPLGTECKDCSV
DKLFDDPMWNQQWYLQDTRMSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDI
YPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGG
IRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRG
GKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSS
GDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEF
DPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHIPEKKQCIVRDETFQPR
PLKAAGEISIEIPTKACAGQANCVVSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLA
ERERDTSSNGFRNWAFMSVHTWGENPTGTWTLKITDTSGRMENEGQIISWKLILHGTSEK
PEHMKEARVYTPYNAVQNDRRGVEPMEDMIKQEAPTPAHKPEISSPVVPDSLPSAASISV
PEENPEAPGSSIANLALLRLLQSAFNRQTPVVPQHALAVPPAPPKTFQPERIPPQKLYQA
LDQLNRYRGSENGLFSDYSDNFYRAQPYRHRDDRLLQALFDMLGDDQQ
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagatgtcgtccaatgttgctgtgcagtattcttgctctgttctgtgcgctg
gtgtcctcagctgtggacagacagtatctgaacgaatgggcggtggagattccaggagga
tacgacaatgcccgatccatagccgacgagctcggatacaaattagtccgacagattgga
gcgctggaaaaccattatttattcaagcggcacagtcaccctagcaggaccaaaagaagt
gcagatcatatcaccaaacgtctgtcggaagatgacagggtctcttgggctgaacagcag
tatgagaaacggagggccaaacgtgccccgctggggaccgaatgtaaggactgctcggtg
gacaaactcttcgacgaccctatgtggaatcaacagtggtatctgcaagacacccggatg
tcatcttccctgcccaaactggacctgcacgtgatcccggtctggaagaagggcattacg
ggcaaaggagtggtcattaccgtgctggatgatggcctcgagtggaaccacaccgacatt
taccctaactatgatcctgctgctagctatgattttaatgacaacgatccagatcccttt
cccagatacgactccaccaatgaaaacaagcatggtacccgatgtgctggagagattgcc
atgcaagcagacaacaacaaatgtggtgtcggtgtggcctacaactccaaagtgggaggg
atacgaatgctggatggaatcgtgacagatgccattgaagccagttccattggctttaac
cctgatcacgtggacatctacagcgctagctggggccctaatgatgacgggaagaccgtg
gaggggcctgggcgcctggcccagaaagcttttgagtatggtatccagaagggtcgtggt
gggaagggctccattttcgtctgggcgtctggtaacggtggtcgtcagggcgacaactgt
gattgtgatggatacacagacagtctgtacaccatctccatcagcagtgcatcccagcag
ggtttgtctccctggtacgctgagaaatgctcctctacactggccacggcctacagcagc
ggagactacaccgaccagagaattactagtgccgatttgcacaatgaatgcacagagaca
cacactggcacgtctgcatctgctccattggctgctgggatatttgcactggctttggag
caaaatcctgatctgacctggcgagaccttcagcacttagtggtttggacgtctgagttt
gatcccctggccaataacccaggctggaaaaggaatggagctggtttgatggtcaacagt
cgttttgggtttggtctcctgaatgccaaagctctagtagatctggccgatcccaaagtc
tggaagcacattccggagaagaaacagtgcatcgtcagagatgagacgttccaaccaagg
ccattgaaggctgcaggtgagatatccattgagatccccactaaggcctgtgcaggacag
gcgaattgtgttgtatctttggagcatgtgcaggtggaggtcagcattgagtacacacgc
agaggagacctgcacatcacgctgacatctccatcaggtaccaccacagtcctgctggcg
gagagagagagggacacatcatccaacggtttccgaaactgggcctttatgtctgtgcac
acctggggagaaaaccccaccggcacttggaccctgaagattacagatacgtctggacgg
atggagaatgagggtcagattatcagctggaagttgattttgcacgggacgtctgagaag
ccagagcacatgaaggaggcgagggtttacacaccctacaatgctgtacaaaacgatcgc
agaggagtggaaccgatggaagacatgatcaagcaggaagctccgactccagctcacaaa
cctgaaatttcaagtccagtggtcccagactcactcccgtctgctgcttccatcagcgtc
cctgaagaaaatccagaagctccaggctcctccattgccaatctggccctgctgcgtctc
ctccagtcggccttcaacaggcaaaccccggtggttcctcagcacgctctggcggttcct
ccggctcctcccaagacctttcagcccgagaggatccccccgcagaagctgtaccaggcc
ctcgaccagctaaaccgctacaggggctccgagaacggcctgttcagtgactacagcgac
aacttctacagagcccaaccatacagacacagagacgaccggctgctgcaggcactgttt
gacatgctcggagacgaccagcagtga

DBGET integrated database retrieval system