KEGG   Sinocyclocheilus rhinocerous: 107749433Help
Entry
107749433         CDS       T04916                                 

Definition
(RefSeq) histone deacetylase 11-like isoform X1
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107749433
Chromosome [BR:srx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     107749433
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 366 aa AA seqDB search
MSKKEDLRGKKGFHQTELYAEVPSTCLPIVYSPEYNITFMGLEKLHPFDAGKWGKVIRFL
KEEQFITDEVIVLAREASEADLLVVHTTRYLNRLKWSLVVATITEIPPLLFLPNFLVQRK
VLKPLRTQTGGTIMAGKLAMDRGWAINVGGGFHHCSSDKGGGFCAYADITLAIKFLFERV
EGVARATIIDLDAHQGNGHERDFLEDRRVYIMDVYNRHIYPGDGYAKRAIKRKVELDWGT
EDMEYLQKVELHSEGALNEVRPDIIIYNAGTDVLDGDPLGGLAISPQGIVKRDEIIFRAA
QRRGIPILMVTSGGYQKKTARIIADSILNLHRQRLIGEEAVEGAGPSHVPLMMSKSVSSG
ATFSAI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaagaagatctgagaggaaagaaaggttttcaccaaactgaactttacgca
gaggtcccttcgacatgcctgcctattgtctattccccagagtacaacatcaccttcatg
ggtctggaaaagctgcatccctttgatgctggcaaatggggcaaggtcattcgcttcttg
aaagaggaacagttcatcaccgatgaggttattgttctagcccgggaagccagcgaggcg
gatcttcttgtggttcacactacgcgttacctgaacagactcaagtggtcgctggtggtt
gccaccatcacagaaatcccacctctcctgttcctgcccaacttcctggtacagcgcaaa
gttctaaaacctttgagaacacaaacgggaggaaccattatggctggaaagctggcaatg
gatcgaggatgggcaataaatgtgggaggaggcttccaccactgctctagtgacaaagga
ggaggtttctgtgcctacgctgacatcacactagctatcaagtttctctttgagagggtg
gagggagttgccagggccaccatcatcgatctagatgcccatcagggaaacggccacgag
cgggatttcctggaagacagacgcgtttacataatggatgtctataatcgccacatctat
ccaggagatggatatgcaaagagggcgattaaacgaaaagtggagctggactggggcaca
gaagacatggagtatctacaaaaggtggagctccattcagaaggggcgctgaatgaagta
cggcccgacatcatcatatataatgcaggcacggacgttcttgatggagaccctctcgga
ggtctggctatatccccacagggtattgtaaagagagatgagatcatcttcagggcagcc
cagcgacgaggaatccccatccttatggtgacgtcagggggctaccagaagaaaactgct
cgcattattgctgattccatcttgaatctgcacagacagcgcttgattggtgaagaggct
gtagaaggtgcgggaccctcacatgtcccgctcatgatgagcaaatctgtgtcatcaggg
gccacgttcagtgccatttaa

DBGET integrated database retrieval system