KEGG   Sinocyclocheilus rhinocerous: 107755990Help
Entry
107755990         CDS       T04916                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107755990 (tmprss9)
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107755990 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 SEA Ldl_recept_a DUF1922
Motif
Other DBs
NCBI-GeneID: 107755990
NCBI-ProteinID: XP_016428440
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MEKKDLNKWPEGDPRPAYLSTCKCMTLAAILILLIIGAAVGFMTAYLIQEEHYFMETVEL
EGLSYDPDLRDKTSGFYVVLTATLKEKIRNIFSASAVASHFIDCQIVAYGNANTNVLTSL
RLVFRISQVQGYTESFVQDLLRSGFKAMLNGKPIVIPDYGEITSIILLGASGKSFYEIGN
DISKCPENTFTCDNGECITKTNPECDSITDCVDGSDETFCSCGTRPAMANRVVGGENGRH
GELPWQVSLRLRGRHTCGASIVNNHWLVSAAHCFETENNPKDWTALVGANLVSGEEGEAT
IINIKSLVVSPRYDPMTTDSDVTVLELETPLTFSSYVQPVCIPSSSHIFSPGQNCIVSGW
GTLNQYTSEVPSTLQKAIVKIIDSKVCNKSTVYRGALTQNMMCAGFLQGKVDSCQGDSGG
PLVCEVSPGRFFLAGVVSWGVGCAQINKPGVYSRVTKLRNWILSYTNTAPTIQVAPTVPS
VTTTTVHIAKVMSLSSEQVSNDYYPATGNCSGNYNCGGDMCISKTNPECDRVADCPNEAD
EKNCDCGNRPAMGQERIVGGVTAHRGEWPWVGSLQYQRTHRCGATLIHCKWLLTAAHCFR
GDLNPGSWTVSLGSVIWSGVGALVIPVQRIIHHPAFNGSTMDFDVALVELSIPAPKSYTI
QTVCLPSPWHSFIKNMECYITGWGAMREDGMITNLLQKAQVNVIDKLDCQQAYGAELTNN
MMCAGSMEGDKDTCLGDSGGPLVCREPQGRWFLAGVTSWGHGCGRLGFPGVYMQVTAVRE
WISIYLPF
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaagacttgaataagtggcccgagggtgatccacggccagcttacctctcc
acttgcaaatgtatgactttagctgccatactgattcttctcatcattggggctgctgtg
ggatttatgacagcttatttaatacaagaggaacattatttcatggaaacagtggaattg
gaaggtctcagttatgatccagatctgcgagataaaacatcaggtttctatgtagttctg
actgcgactctgaaagaaaagatcaggaatatctttagtgcctctgcagtggcaagtcac
tttattgactgccagatagttgcatatgggaatgccaacacaaatgttttgacctctcta
cgtttggtcttccggatctctcaagtccaggggtatacagagagttttgttcaagacctc
ctccgctctggatttaaggccatgttgaatgggaaacccattgttatcccagattatgga
gagatcactagcatcatccttcttggagcaagtggaaagtcattctatgagattgggaat
gacataagtaaatgtcctgagaacacattcacttgtgacaatggcgagtgcatcacaaaa
acaaatccagaatgtgactctataaccgactgtgttgatggttcagatgaaaccttttgc
tcctgtggaacacgtccagccatggctaaccgtgttgtgggtggtgaaaatggccgtcat
ggggagctaccctggcaggtcagtctgagactacgtggccgtcatacctgtggtgcatcc
atcgtcaacaatcattggctcgtcagcgctgcccattgttttgaaacagaaaacaaccca
aaagattggacggctcttgtgggagccaatctagtcagtggggaggagggcgaagccacc
ataataaacatcaagtcgctggttgtctctccgagatacgatcccatgaccactgacagt
gatgtgaccgtgctggagttggaaacaccattgacgttcagctcttatgttcagccagtc
tgtatcccatcatcctctcatattttcagtcctgggcagaactgcatcgtctctggctgg
ggaactcttaatcagtacacaagtgaggtgccttcaacattacagaaggcaatagtgaag
atcattgactcgaaagtttgcaacaagtcaactgtatacagaggtgcacttacccaaaat
atgatgtgtgctggatttcttcaagggaaggtggactcttgtcagggagattccggaggc
cctctggtatgtgaggtgtcccctggacgctttttcctggctggcgtggtgagctgggga
gtgggatgcgcacagatcaacaagcctggagtctattcccgcgttaccaagctccgcaac
tggattctgagctacaccaatactgcaccaacaatccaagtcgcccccactgtccctagc
gtcacaaccactacagttcacattgctaaagttatgagcctatcctctgagcaagtcagt
aatgattattaccctgctactgggaactgcagtggtaattataactgtggcggagacatg
tgcatcagcaagacaaacccagagtgtgacagagtcgctgactgccccaatgaggctgac
gagaaaaactgtgactgtgggaatcgtccagctatgggccaggagaggattgttggtggt
gtcactgcccatagaggtgaatggccatgggtgggcagtctgcagtaccaacgcactcac
cgctgtggagctacgcttatccactgcaaatggctcctgactgcagctcactgcttcaga
ggtgacctgaaccctggcagctggacggtaagtcttggctcggtcatttggtctggagtg
ggtgctctggtgattccagtgcaaaggatcatccatcatcctgctttcaatggcagcacc
atggacttcgatgtggccctggtggaactctccatccccgccccaaagtcctacaccatc
cagactgtgtgtttgccttctccctggcatagcttcatcaaaaatatggaatgctacatc
actggatggggtgctatgagggaggatggtatgataaccaatttactgcaaaaagcacag
gttaatgtcattgataagttggactgccagcaagcttacggtgctgaacttaccaacaac
atgatgtgtgctggctctatggaaggagacaaggacacatgtctgggagactcagggggc
cctctggtgtgccgcgaaccccagggccggtggtttctggctggggtgaccagctggggt
cacggctgtggtcgacttggcttcccaggagtttacatgcaggtcacggctgtcagagaa
tggatatctatatacctccctttttaa

DBGET integrated database retrieval system