KEGG   Sinocyclocheilus rhinocerous: 107758779Help
Entry
107758779         CDS       T04916                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107758779
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 740 aa AA seqDB search
MSSASEHTPDGLPEHLNFTNSQSFSLLVEMLRSNTNTAGGPSASAPAAATPAASDTLLTV
HSVDLLKSKDGPNRREHRTDAYFSDKLIVRRGQTFQMWIEFSRPFNPKSDKLQLQLKLEP
IFSSSTGIHISVPLVDVLEDGRWEMKIVEQKDKRVRLAVNTLPTASIGRYKVTVESFSPK
GKLLFPCTPNDVYLLFNPWCEDDAVYLDNEAERKEYILNSMGRIYYGTEKQIGTRTWNFA
QFEQDILEACLFILERGQVAMTEWRDPVIVSRMVSALVNSNDDYGVLMGNWKDSYEGGTS
PTAWSGSGDILRQYYKSSGKPVKFAQCWVYAGVTNSVLRCLGIPTRCVTNFSSAHDTDLS
LTTDIYIDEKLEVIKDKTSDSVWNFHVWNESWMTRPDLPAGYGGWQVVDATPQEPSQGSY
RCGPTSVSAVRKGQVELKFDTPFVFAEVNSDRIYWQKKPDRSFSQVNVEKNSIGQSISTK
AVGSDARVDITHLYKYPEGSEEERIAVERASRFGSKPTLYPSPTGNDVSVEIVMDGAGPR
IGGDAKLSIVLKNKSSSQRTASLLYEVMVMYYTGVLKTTVKKDQIPLTLKPQETKTIPWT
LQYKEYMSHLVDQGALMLAVTGRVNETRQILATQFNFRLRTPDLIITPQGDAVVGKELTV
KITFQNPLSQVLRNVLFRIEGLGMQSVRKIAYGDVDKLATVTLTEKFVPTVAGSQKLLAS
MDCRLLTQVHGVADIVVKPK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcttcagaacacacaccagacggtctgccagagcacctgaacttcaccaac
tcacagtctttcagcctgcttgtagaaatgcttagatctaacaccaacactgctggaggt
cccagtgccagcgctcctgcagctgcgaccccggcggcttcagacacgcttctgacggtt
cactccgtcgacctcctgaaatccaaggatgggccgaaccgacgcgagcatcgcacagac
gcttacttcagcgacaagctgatcgtccgcagaggacagaccttccagatgtggatcgag
ttctccagacccttcaaccccaaatctgacaagctgcagctgcagctgaagttagagccc
atcttcagcagtagcactgggattcacatctctgtcccgttagtggacgtcctggaagac
ggccgctgggagatgaagatcgtggagcagaaagacaaacgcgtgcggctggcggtcaac
actcttcccaccgcctccatcggccgctacaaggtgaccgtggagtctttctcaccgaag
ggcaagctgctgttcccctgcacccccaacgacgtctacctgctcttcaacccctggtgt
gaagatgatgccgtgtatctggataatgaagcagaaaggaaagagtatatcctgaatagc
atgggcagaatttactacggaactgagaagcaaattggaaccagaacatggaattttgcc
cagtttgaacaggatatcctggaagcatgtctgttcattttggagagaggtcaggtcgct
atgaccgaatggagagatccagtgattgtgtccagaatggtatctgctctggtgaactcc
aacgatgactacggtgttctgatgggtaactggaaggacagctatgagggcgggacgtct
cctaccgcctggagcggcagcggcgacatcctgagacagtattacaaaagctcagggaaa
cctgtcaaattcgcccagtgctgggtctatgcgggagtcaccaattcagtgttgagatgt
cttggtattcccacccgttgtgtgaccaacttcagctcggctcatgacacggacctttcc
ttgaccacagacatttatattgacgagaagctggaagttatcaaagacaagaccagcgat
tctgtctggaacttccatgtgtggaacgagtcctggatgacccgtccggacctcccggct
ggttacggcgggtggcaggtggtggacgcgacccctcaggagcccagccagggttcgtac
cgctgcggtcccacttccgtctccgctgtccgcaaaggacaagtcgaactgaaattcgac
actccgtttgtctttgccgaagtgaacagtgataggatctactggcagaagaaacccgat
agaagcttcagtcaggttaatgtggagaagaactccatcggtcagagcatcagtactaaa
gctgtgggatctgatgctcgtgtggacatcacacacctctacaaatacccagaaggttca
gaggaggagcgcattgctgtggaaagggccagtcgcttcggctccaaaccgactttgtat
ccgtctcccaccggcaatgacgtgagcgttgagattgtcatggacggggcagggcctcgt
atcggtggagatgccaaactctccatcgtcctgaagaacaaaagctcaagtcagcgcacg
gccagtctgctgtatgaggtgatggtcatgtactacaccggcgtgctgaaaaccactgtg
aagaaggatcagattcctctcaccctcaaaccgcaagagaccaagactattccttggact
ctgcagtataaggagtacatgagccatctggtggaccagggcgctcttatgctagcggtc
actggacgggtcaacgagacccgacagattctggccacacagttcaacttcaggctgcgc
acaccagacctcatcatcactcctcaaggggatgctgtggtgggtaaagagttgacagtc
aagatcacgttccagaacccgctgtcacaagtgttgaggaacgttttgttccgtatagag
ggattgggaatgcagagcgtcaggaagatcgcgtatggtgatgtggataagcttgcgacg
gttacactgacagagaagtttgttcccactgtcgccggctctcagaagctcctggcatcg
atggactgccgtctgctcactcaagtgcacggagtcgctgatattgtggtcaaaccaaag
taa

DBGET integrated database retrieval system