KEGG   Serratia plymuthica S13: M621_05840Help
Entry
M621_05840        CDS       T02716                                 

Definition
(GenBank) polyketide synthase
Organism
sry  Serratia plymuthica S13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1235583..1243421
Genome map
AA seq 2612 aa AA seqDB search
MPSHQLFNRGFNSFNQLLPELAVQHTDKTAFEFLRSAKEIKNQSYRQLHQRAASLASTLQ
QYGHRGDRVILLYPDGEDFIGAFFGCLYAGMIAVPVPMPAKASGSAWERFIGVLRNAQTE
FIVTTGKGAETLISLGLPLAPLIFTFDQLPAVALPAGYRLQHLDSHFSGAFNPAPVNDDD
VAFLQYTSGSTGTPKGVMVTHGNLWANSQAIHRYFGHHNESRGMIWLPHFHDMGLIGGLL
QPVFGAFPCRVMSPMMLMKNPLNWLKQVSEFRATTSGGPNFAYDLCVRKISPQQAEDLDL
SNWDVAFCGAEPIRPATLRQFSEHFAPAGFRGQAFLPCYGMAETTLIVTGREKGQGMAVA
EEKAGDVVNCGEALPGTDVRIVDPETLQPLAAGQTGEIWLRGPSIAAGYWNNPAATEATF
QARIEPDPAHWLRSGDLGFLQAGALYVTGRVKELLIVNGQNHYPTDIEETIREADILLAD
ATVCVFAAEVAETEQAVALLEIPERLKETLDTAALNRRLNAAVAERHGITLGEWVWVGRR
AIPRTTSGKLQRTRAREMYRQNELTVQWRSRAEPPQTAQVADVASYSAPALAALVAGIIG
TAVNGAVGEEQWDEAFTAFGLNSLQAVGVIGELEQHLGRELSPALIYDYPTINKLAAGLL
QPTERPEALATAVAGQDIAVIGIGVELPGHSGVQALWAMLQQGQSTTGEIPAHRWAGSAL
GGFNRKGSFFDRVSDFDAGYFGISPREAEYIDPQHRLLLETVQQALTDAGLQASALRGSD
TAVFIGISASDYALVSGDRVSAYSGLGNAHSIAANRISYLYDFKGPSVAIDTACSSSLVA
IDGAMQSLRSGRCSLAIAGGVNLALTPHLQKVFTEAQMLAPDGQCKTFDARADGYVRGEG
CGIVVLKPLAQALADGDRVYATLVASAINQDGRSNGITAPNGPSQQAVIARALAEAGIDS
NHIDYVEAHGTGTALGDLIEYQALEAVFAERSQPAPVQVGSIKTNIGHLEAAAGVLGVVK
TALMLHSQHRVPHLNFQQKNPHIAAISRRVAVAGSHPCAWESAAGQRYAGVSSFGFGGTN
SHVILRDCPQAVKRDEAAQPLTLLLVASHEEQGFNAQRDGIYSTLQMQHDVDVPAWCRLV
NTRYDHPRYRGFAYGANRRQLAENLAQLTANKVEKPRPQVWLFPGQGTQQIGMGAALYQH
LPHYRRCFDNLAERVQEEYQIDIRQALHAQDDSWQYCAKTCQLALFACSYATADSLLQFG
LRPAAVIGHSLGEYCAAVVAGQISLEQGLAMVHQRARLMGSLEQQGAMAVVFSGENEVRR
RIAPWADDIDIAAFNTPTLTTITGSSPAIDACLQAISAQGGHARRIKTTNAFHSHLMDPI
LPAYRLWLTQHIDFAEGNIPFYSNLDALPRRHTDADYWSQQIRQPVHFLQGIQALREEGK
YTFVDLSADSSLGKFVAATDRSQPILAAADHRHEYQSLLTLLGSLWQQGHDIDWSRLYRA
TSREALTLPAIQFCRKTFWLADETPTLPPSSHEDAMSKQHQLHAEIKAIIAGYLGASPEA
LDDDLPFLEMGADSLVLLDAINTIKDRYGVVIPLRSLFEELNTLDAVIHYVVERAQVPEP
VAVVSESRVVTAMPQADASVMPASAPQLEPEGGIPATAPAELQGVIARQLEVMSQQLRLL
SGGHAQSLSAPALPSAPASAPVAALPAPAVASNAPAIAAPAKAGAHASWFKKETRKTSLG
AERDKHIQQLTQQFVSKTPSSKHNAQQYRAVLADNRASAGFRLSTKEMLYPLVGVRSQGS
RIWDADGNEYIDFTMGFGANLLGHAPECVQQAVAAQLAQGMQIGPQSPLAGEVATLIAEL
TGQHRVAFCNSGSEAVMSAVRLARAVTGKNKVALFSGSYHGVFDGILGRQQGGETPERAV
PIAAGTTASLVEDLLVLDYGSEESLALIAQYADQLAAVIVEPIQSRYPDHQPRDYLHALR
KLTAERNIALMFDEVITGFRLAAGGAQAYYGVQADIATYGKIVGGGMPIGVIAGSARFMD
SIDGGFWQYGDESWPQSELIFFAGTFSKHPLTMAASKAVLDYIKSHPGLYDDINQKTHYL
AQTLNTWFVTTGTPIEIVSAGSLFRFKFSGNYDILFHHLMLRGIFIWEGRNCFVSTAHSS
QDIEHFIAAVKESVNAMRVDGFFGDAGLHPEMPYPAADSQQRFMLLAAKDESGLCAGNIG
CVVETAREIEGSLLAEAWTLLSERHESLRMQFNDAGELRVVPGGSSVDFIEERSESAEVA
ARLAEFAAKPFALTAAPLARVLLLSQPGQIALALTAHHTVADGWSFMVMLRELLHIYDAL
AAGFSPELSAAPSYLRFMRAEKTANDIEVAQRLAAIPAHRFDPASALPVVLQAAPYQGQR
LKQGLAYPNLSAQLRKVAAELRTTRFVMLNALFVLTLEKFVGHSVLPVAVPNAGRDFENS
EGLVGQCVSLMPLCFNSAASASLPEFVAKVHQAILAQRDAPALPSRCFHGEQAPLPLLAT
FNVEPSVPLAEMRQWQASLSMLPVNAVEFPLMINVVEMADELSIELDYQARYFTEQTASA
LLEPYLAAIAVLAEQGVSAVNQQFYSPVAVEA
NT seq 7839 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatcagttgtttaacaggggatttaattccttcaaccaactattgcccgag
cttgctgttcaacataccgacaagacggcatttgaatttttgcgaagtgccaaagaaata
aagaatcaaagttatagacaattgcatcagcgcgccgcatctctggccagcacacttcag
caatacggtcatcggggcgacagggttattttactttaccccgacggcgaagattttatt
ggcgcttttttcgggtgcctttatgccggcatgattgccgtgcctgtccctatgccggcc
aaggcctcaggcagcgcgtgggagcgctttattggggttttacgcaatgcgcaaacggaa
tttatcgttaccacaggcaaaggcgctgaaaccttaatatcgctcggtttaccgctggcg
ccgctaatttttacctttgatcaactgcccgcagtggcattgccggcggggtatcgcctt
cagcatctcgatagccatttttcaggggcgtttaatcctgcaccggtgaacgacgacgat
gtggcttttttgcaatacacctcgggttcaaccggtacgccaaaaggggtcatggtcact
catggcaacctgtgggccaactctcaagccatccatcgttatttcggtcaccacaatgaa
agccgcggcatgatatggctgccgcatttccatgatatggggctgatcggcggtttgctt
cagccggtattcggggcattcccctgccgggtgatgtcgccgatgatgctgatgaaaaac
ccgcttaactggttaaagcaggtgtcagagttccgtgcgacgacgtcgggcggccctaat
ttcgcctacgatctctgcgtgcgcaaaatcagcccgcagcaggccgaagacctggatctc
tccaattgggatgtggcgttttgcggtgcggagcctatccggccagccacgttgcgccag
ttcagtgaacactttgccccggccggttttcgggggcaggcgtttttaccctgctatggc
atggcggaaaccacgctgatcgttaccggcagggagaaaggccaggggatggcggtcgcc
gaagaaaaagcgggggatgtcgtcaactgtggcgaggcgttgcccggcaccgatgtccgc
attgtcgatcccgaaacgctacaaccgctggcggccgggcaaaccggcgagatctggttg
cgtgggcccagcattgcggccggctattggaataacccggcggcgacagaggccaccttc
caggcgcgcatcgagcctgatccggcgcattggctacgcagcggcgatttggggttcctg
caagcgggggcgctgtacgtcaccggacgtgtgaaagaacttctgatcgtcaatgggcaa
aaccattacccgacggatatcgaggaaacgatcagggaagcagatattttgctggcagac
gcaaccgtttgcgtctttgccgccgaggttgccgaaacggaacaggcggtggctttgctg
gagatcccggaacgtctcaaagagaccctggacaccgcagcgttgaaccggcgtttgaat
gccgcggtggccgagcggcacggcataaccctgggggaatgggtatgggtcggtcgccgg
gccattccacgcaccaccagcggcaaattgcaacgtacacgcgccagagaaatgtaccgg
caaaatgaactgacggtgcaatggcgtagccgggccgagccgccgcaaaccgcccaggtt
gccgatgttgcctcatacagcgcgcctgccctggccgcgcttgtcgccggtatcatcggc
actgcggtcaacggcgctgtcggtgaagaacagtgggatgaggcctttactgcctttggc
ctgaactcgttacaggccgttggcgtgatcggcgagttagaacaacatttggggcgtgag
ctgtcgccggcgctgatttacgattatccgacgatcaataagctggctgcgggtctgttg
caacccactgagcgaccggaagcgcttgcgacggccgtggccggccaggatatcgccgtg
attggcatcggggttgaactgccaggccacagtggcgtgcaggcgctgtgggcaatgttg
cagcaggggcaaagcaccacgggtgaaatccccgctcaccgttgggccggctctgcactc
ggcggttttaaccgcaagggtagtttctttgaccgcgtgagcgattttgacgccggttac
tttggcatttcgccgcgcgaggcggagtatatcgacccgcaacatcgcctgctgttggaa
accgtgcaacaggcgctgaccgatgcggggttacaggcttcggcgctgcggggtagcgac
accgcggtgtttatcggcatcagcgccagcgattatgccctggtctcgggcgaccgggtt
tccgcgtatagcgggctgggcaatgcgcacagcattgccgccaaccgcatatcttatctt
tatgattttaaagggccaagcgtcgccatcgataccgcctgctcctcttcgctggtggcc
atcgacggggccatgcaaagcctgcgctcggggcgctgttcgctggctattgccggcggc
gtgaatctggcgttgacgccgcatttgcaaaaggtcttcaccgaggcgcagatgttggcg
ccggacggccagtgcaaaacctttgacgcgcgcgccgatggctatgtgcgtggcgagggg
tgcggcatcgttgttttgaaacccctggcgcaggcattggccgatggcgatcgggtttat
gccaccttggttgccagcgccatcaatcaggatggccgcagcaacggcatcacggcacct
aacgggccatcgcagcaggcggtgatcgcgcgggcgctggccgaggcgggcatcgacagc
aatcacatcgactatgtggaagcgcatggcaccgggacggcgctgggcgatctgatcgag
tatcaggcgctggaagcggtgtttgccgagcggagccaaccggcaccggttcaggtagga
tcgatcaagaccaatattggccatctcgaagccgcagccggcgtgcttggggtggtgaag
accgcgttgatgctgcatagccaacaccgcgtgcctcatttgaatttccagcagaaaaac
ccgcatatcgccgccattagccgccgggtggcggtggcgggcagtcacccttgcgcctgg
gagtctgcggcgggccaacgttatgccggtgtcagcagttttggcttcggcgggacgaac
agccacgtgatactgcgtgattgcccgcaggccgttaagcgcgatgaggcggcccagccg
ctgacgctgctgctggtggcctcgcacgaagagcagggtttcaacgcgcagcgtgacggc
atttatagcaccttgcaaatgcagcacgacgttgacgtcccggcatggtgtcgcctggtc
aatacccgttatgaccacccgcgctatcgtgggtttgcctatggcgccaatcgccggcaa
ttggcagaaaacctggcgcaactcaccgcgaataaagtggagaaaccgcgcccgcaggtc
tggctcttccctgggcagggaacgcagcaaatcggtatgggggcggcgttataccagcat
ctgccgcactaccgcaggtgcttcgataacctggctgagcgggttcaggaagagtatcaa
atcgatattcggcaagcgctgcatgcgcaggacgacagttggcagtattgcgccaaaacc
tgccagttggccctgtttgcctgcagctatgccacggcggacagcttgttgcagttcggg
ctacgcccggcggcggtgattggccatagcctgggcgagtattgcgctgcggttgtcgcc
ggccagatttcgctggagcaggggttggcgatggttcatcagcgcgcacgcctgatgggc
agcctggagcagcagggcgcgatggcggtggtgttcagcggcgaaaacgaggttcgccgc
cgtatcgccccttgggccgatgatatcgatattgccgcgttcaatacgccgacgctgacc
accatcaccggcagttcgccggcgattgacgcttgtctgcaggcgatttcggcgcaaggt
ggccatgcccgccggatcaaaaccaccaacgcattccattctcacctgatggatcccatc
ttgccggcgtatcgcctttggttgacgcagcatattgatttcgccgaggggaatatccct
ttctacagcaatctggacgctctgccgcgccggcacaccgatgccgactactggagccaa
caaatccggcaacccgttcatttcctgcaaggcatacaggcgctgcgggaggaagggaaa
tatacctttgtggatctgagcgccgacagttcgctgggcaagttcgtcgccgccaccgat
cgcagccaaccgattttggcggccgccgatcatcgccatgaataccaatcactgctgacg
ctgctgggttcgttgtggcagcaagggcatgacatcgactggtccaggctgtatcgcgca
acaagtcgtgaagcgttgacgctgccggccattcaattttgtcggaaaactttttggctg
gccgatgaaacgccaacgctgccgccatcttcacatgaggacgctatgtcaaaacaacat
caattacacgccgaaatcaaagcgatcattgccgggtatttgggggcatcgcccgaagct
ctggatgatgatctgcccttcctggaaatgggggccgactcgctggtcttgctggatgcg
atcaataccatcaaggatcgctatggcgtggtgatcccgctgagatcgctgtttgaagag
ttgaatacgctggatgcggtgatccattacgttgtggaacgtgcgcaagtgccggagccc
gtcgcggtggtcagtgaaagccgggttgtgacggcaatgccgcaagccgacgcttcggtg
atgcctgcgtcggcccctcagctcgaaccggaagggggaataccggcaacggccccggcc
gagttgcaaggcgtgattgcgcggcaattagaggtcatgtcgcaacagctgcgcctgtta
agcggcggccatgctcaatcgctttccgcacccgcgttgccttcggctccggcaagcgcg
ccggtagccgcacttcctgcaccggcagtggcgagtaatgcgcctgctatcgctgcaccg
gccaaagccggcgcgcacgctagctggtttaaaaaggaaaccaggaagacgtcattaggg
gccgagcgcgataaacacatacagcaattgacgcagcagtttgtcagcaaaaccccgagc
tccaagcacaatgcgcagcagtaccgcgccgtgctggcggataaccgggcatcggcgggt
ttccgtttatccacgaaggaaatgctgtatcccctggtgggcgtgcgttcacaaggctcc
cgtatttgggatgccgacggtaacgagtacattgatttcaccatggggtttggcgccaac
ctgttgggccatgcacctgagtgcgtgcagcaggccgttgccgcacagctggcgcaaggc
atgcaaatcgggccgcagagcccgctggccggtgaggtcgcaacattgattgcagagctg
acgggccagcaccgtgtggcgttttgtaactccggttctgaagccgtgatgagcgcggta
cgcctggcgcgtgccgtaacgggcaagaacaaagtggcgctgttcagcggctcttatcac
ggcgttttcgatggcatcctggggcgccagcagggtggcgaaaccccggagcgggcagtg
ccgattgccgcagggacgacggcgtccctggtcgaggatctgctggtgctcgactacggc
agtgaagagagcctggctttgattgcccagtatgccgatcaactggccgcggtcattgtg
gagccgattcaaagccgctaccccgatcatcagccgcgcgactatttgcatgcgctgcgt
aagctgacggccgagcgcaatatcgccttgatgttcgatgaagtgattaccggtttccgc
ctggcagccggcggcgcgcaggcgtattacggtgtccaggccgatattgccacctacggc
aagattgtcggcggcggcatgccgattggcgtcattgcggggtcggcgcgctttatggac
agcatcgacggcggtttctggcaatacggcgatgaatcctggccgcaatccgaactgatt
ttctttgccgggaccttctccaaacaccctctgaccatggcggccagcaaagcggtgctc
gactatatcaagagccaccccgggctctatgacgacatcaaccaaaagacgcattacctc
gcgcagacgctcaacacctggtttgtcacgacgggtacgccgatcgagatcgtctcggcg
ggcagtttgttccgtttcaaattcagcggtaactacgacattctgttccaccacctgatg
ctgcgcggcatcttcatttgggaaggccgcaactgcttcgtgtccaccgcgcactcttcg
caagatatagagcactttatcgcggcggtaaaagagagcgttaatgccatgcgcgttgac
ggtttcttcggtgatgccggtttgcaccccgagatgccttacccggccgccgacagccag
cagcgctttatgctgctggccgccaaagacgaaagcgggctgtgcgcgggcaacattggc
tgcgtggttgaaacggcgcgggaaatcgagggatcacttctggccgaagcctggacgctg
ctgagcgagcgtcatgagtccttgcgtatgcagttcaatgacgcgggggagttgcgggtg
gttccgggcgggagcagcgtcgattttattgaagaacgcagcgagtcggcagaggttgcc
gcacggctggccgagtttgccgccaaacccttcgccttgacggcagcgccgctggcgcgc
gtcttattgctgagccagcccggccaaatagccctggcgttgacggcgcaccatacggtg
gcggatggctggtcatttatggtgatgctgcgtgaactgctgcatatctacgatgcgctg
gcggcagggtttagccctgagctgtcggcggcgccaagttatttgcgttttatgcgtgcg
gaaaagaccgccaatgatatagaggttgctcaacggctggccgctatccccgcgcatcgt
ttcgatcccgccagtgcgctgccggttgtcctgcaggccgcgccgtatcaaggccagcgt
ttgaagcaagggctggcttacccgaacttgtcggcccaactgcgtaaagtggccgccgaa
ctgcgcacaacccgctttgtgatgctgaacgccctgtttgtactgacgctcgagaagttt
gtcggccactctgtgttacctgtcgcggtgccgaatgccgggcgtgacttcgagaacagc
gaagggctggtcggccaatgcgtcagcctgatgccgttgtgtttcaacagcgccgcgagc
gcttcgttgcctgagtttgtggccaaggtgcatcaggccattctggcgcagcgtgacgcg
ccggcattgccgtcccgctgtttccatggcgagcaagcgccactgcctctgcttgccacg
ttcaatgttgagccgtccgttccgttggcggaaatgcgccagtggcaggccagcctgtcg
atgctgccggtcaacgcggtcgagtttcccttgatgatcaacgtggtggaaatggccgat
gagctgtcgattgagttggattatcaggcgcgttatttcaccgagcaaaccgcctcagcg
ctgctggagccgtatctggctgcgattgcggttctggcagagcaaggcgtgagcgccgta
aatcagcagttttattcaccggttgccgtggaagcatga

DBGET integrated database retrieval system