KEGG   Streptococcus salivarius HSISS4: HSISS4_01438Help
Entry
HSISS4_01438      CDS       T04634                                 

Gene name
amyL2
Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HSISS4_01438 (amyL2)
Enzymes [BR:ssah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HSISS4_01438 (amyL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1631799..1633250
Genome map
AA seq 483 aa AA seqDB search
MTNQTAMQYFEWYLPSDGQHWNNLAEDAQHLADLGISHVWMPPAFKATNKDDVGYGVYDL
FDLGEFDQKGTVRTKYGLKEEYLNAINQLKEVGIVPMADVVLNHKAAADKLETFEVVEVD
PEDRTQEISEPFEIEGWTHFTFDGRNKAYNDFEWHWYHFNGTDFDAKRNKSGIYLIQGDN
KGWADNDLVDNENGNFDYLMYANLDYKHPEVIENIYEWADWFVETTGVQGFRMDAIKHID
SFFMRNFIRDVKEKQGQDFYVFGEFWNGNEDDNNTYLEKIEKRFDLVDVPLHNNLHNAST
AGADYDLTTIFDHSLVKNHPEHAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLREDG
LPCLFYGDYYGIEGEFAQENFQETLDTLLYARKDLAYGEQTDYFDNPNCIGWTRSGNEDG
APLAVTISNDAANSKSMEIGSDWAGQTFYDILGNCSDTVTIDEDGWGDFPVSEKSVSVWT
IQD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcaaaccgcaatgcaatactttgaatggtatctcccaagtgacggacaacac
tggaacaatttggctgaagatgcccaacatttagcagacctaggcatcagccacgtttgg
atgccacctgcttttaaagctaccaacaaagatgacgttggttacggagtctatgacctc
tttgaccttggagaattcgaccaaaaaggaactgtccgcaccaaatacggccttaaagaa
gagtatctcaatgctatcaaccaactcaaagaagttggtatcgtacctatggccgacgtt
gtgcttaaccacaaggccgcagctgataaactcgagaccttcgaagtggtcgaagttgac
ccagaggaccgtacccaagaaatcagcgaaccatttgaaatagaaggctggacacacttc
acctttgacggacgcaataaggcctacaacgattttgaatggcactggtaccactttaac
ggaactgacttcgatgctaaacgtaataaaagtggtatctatcttatccaaggtgacaac
aaaggttgggcagacaacgacttggttgacaatgagaatggtaactttgactaccttatg
tatgctaacctagactataaacaccctgaagttatcgaaaacatttatgaatgggcagat
tggttcgttgaaacaacaggcgttcaaggcttccgcatggatgctattaagcacattgat
tctttctttatgcgtaattttattcgcgatgtcaaagaaaaacaaggtcaagacttctat
gtctttggtgaattttggaatggtaacgaagatgataacaatacctatcttgaaaagatt
gaaaaacgttttgacctcgttgatgttccccttcacaacaatctacacaacgctagcaca
gctggagctgattatgatttaacaacaattttcgatcattctttggtcaaaaatcatcct
gaacatgccgtgaccttcgtagacaaccacgacactcaacgcggacaagctctagaatct
actgttgaagaatggtttaaaccagctgcttatgctctcattcttctccgtgaagacggt
cttccttgcctattttatggtgactactatggaatcgaaggtgaatttgctcaagaaaat
ttccaagaaaccctagataccttgctctacgctcgtaaagacctagcttacggagagcaa
acagactactttgataatccaaactgtattggatggacacgctctggcaacgaagatggc
gctccattagctgtaacaatctctaatgatgctgctaacagcaagtctatggaaattggt
agtgattgggctggacaaaccttctatgacattcttggaaactgctctgatactgtaacc
attgacgaagacggatggggagacttcccagtttctgaaaaatctgtcagcgtttggaca
attcaagactaa

DBGET integrated database retrieval system