KEGG   Spiribacter salinus: SPISAL_03800Help
Entry
SPISAL_03800      CDS       T02685                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ssal  Spiribacter salinus
Pathway
ssal00020  Citrate cycle (TCA cycle)
ssal00480  Glutathione metabolism
ssal01100  Metabolic pathways
ssal01110  Biosynthesis of secondary metabolites
ssal01120  Microbial metabolism in diverse environments
ssal01130  Biosynthesis of antibiotics
ssal01200  Carbon metabolism
ssal01210  2-Oxocarboxylic acid metabolism
ssal01230  Biosynthesis of amino acids
Module
ssal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ssal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPISAL_03800
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPISAL_03800
Enzymes [BR:ssal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SPISAL_03800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGM40854
UniProt: R4V4H8
LinkDB All DBs
Position
complement(773244..774542)
Genome map
AA seq 432 aa AA seqDB search
MSTLQVPADGAPITLDNGVLNVPDNPIITYIEGDGIGVDITPVMQRVVDAAVEKAYGGQR
KIHWMEVLAGEKANNELGAWLPDETVEAIRKYLISIKGPMTTPVGGGIRSLNVALRQVLD
LYVCLRPVRWFNGVPSPVKHPDQVDMAIFRENTEDIYAGIEFEAGSSENEQFKQFLAEHF
PSAYANIRFPEECGFGIKPISREGTERLVRAAIRYAIDNQRKSVTIVHKGNIMKYTEGAF
RTWAYELAEREFGAETYTWSEWERTVAEKGQEAANAEQDAAVAAGRVLVKDSIADITLQQ
VLTRPTDFEVIATMNLNGDYLSDALAAQVGGIGIAPGGNINEQTGHAVFEATHGTAPKYA
GKDMVNPGSIVLSAEMMLRHLGWSEAADLVLVGMDAAIASKNVTYDFARLMDGATKVSCS
QFGEAIVKRMQA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcacactccaggtccccgcggatggcgcacccatcacccttgataatggcgtgttg
aacgttcccgataaccccatcatcacctacatcgaaggggatgggatcggcgttgatatc
acgcccgtcatgcagcgcgtggtggatgccgcggtggaaaaggcctatggcggccagcgc
aaaatccactggatggaagtgctcgccggcgagaaggccaataatgagctgggtgcctgg
ctacccgacgagaccgtcgaggccatccgcaagtacctgatttcgattaagggcccgatg
accacgccggtcggcggcgggatccggtcacttaacgtggcgcttcgccaagtgcttgac
ctgtatgtgtgcctgcgccccgtgcgctggttcaacggcgtgccatccccggtcaagcac
cccgatcaggtggacatggccatctttcgggagaacaccgaggatatctacgccggcatc
gagttcgaggcgggttccagtgaaaacgagcagttcaagcaattcctcgccgagcacttc
ccctccgcttacgccaacatccgcttccctgaggaatgcggctttggcatcaagccaatc
tcccgcgagggcacggagcggttggtgcgcgccgccattcggtacgccatcgacaaccag
cgcaagtcggtgacgattgtccacaagggcaacatcatgaagtacaccgaaggcgccttc
cgcacctgggcctatgaactcgccgagcgcgagttcggtgcagagacgtacacctggagt
gagtgggagcggactgtcgcggaaaagggtcaggaagcggccaacgctgagcaggacgcc
gcggtcgcagccggccgggtccttgtgaaagactccatcgccgacatcacgttgcagcag
gtgctcacccgtccgaccgacttcgaagtcatcgcgacgatgaacctgaatggcgactac
ctgtctgatgcgctcgccgcgcaggtcggcggaatcggcatcgccccgggcggcaacatc
aacgagcagaccggccatgccgtattcgaggccacccatggcaccgccccgaaatatgcg
ggcaaggacatggttaacccgggctccatcgttctgtccgcggaaatgatgctgcgtcac
ctcggttggagcgaggcggccgacctggtcctcgtggggatggatgcggccattgccagc
aaaaacgtcacctatgacttcgctcgcctcatggacggcgccaccaaggtcagctgctca
cagttcggcgaggccatcgtcaagcgcatgcaggcctag

DBGET integrated database retrieval system