KEGG   Spiribacter salinus: SPISAL_07340Help
Entry
SPISAL_07340      CDS       T02685                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ssal  Spiribacter salinus
Pathway
ssal00020  Citrate cycle (TCA cycle)
ssal00270  Cysteine and methionine metabolism
ssal00620  Pyruvate metabolism
ssal00630  Glyoxylate and dicarboxylate metabolism
ssal00680  Methane metabolism
ssal01100  Metabolic pathways
ssal01110  Biosynthesis of secondary metabolites
ssal01120  Microbial metabolism in diverse environments
ssal01130  Biosynthesis of antibiotics
ssal01200  Carbon metabolism
Module
ssal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssal_M00012  Glyoxylate cycle
ssal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPISAL_07340
   00620 Pyruvate metabolism
    SPISAL_07340
   00630 Glyoxylate and dicarboxylate metabolism
    SPISAL_07340
  Energy metabolism
   00680 Methane metabolism
    SPISAL_07340
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPISAL_07340
Enzymes [BR:ssal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SPISAL_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C TPP_enzyme_M Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AGM41562
UniProt: R4VM77
LinkDB All DBs
Position
complement(1508224..1509204)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGDMLGPDQPVILQLLEVPPAMDAVQGVVMELDDC
AFPLVAGLQATDQAEEAFKDADYILLVGAKPRGPGMERKDLLEANAAIFSAQGKAMNDVA
SRNVRVLAVGNPANTNALIAQRNAPDLDPNCFTAMTRLDHNRALAQLANRTGQHVTDIQQ
LTIWGNHSATQYPDISHAQVDGKAASDLVDQSWLEESFIPTVQQRGAAIIKARGQSSAAS
AASAAIDHMRDWTLGTPQGDWVSMAIPSDGSYGIAEGIIYSFPVRCANGQYQIVQGLDIS
DFSRERMSATEQELIEERDAVEHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctccggttcgtgttgccgtcaccggcgcagcaggccagatcggctatagtctt
ttgttccgaattgcctcgggcgacatgctggggccggatcagccggtcatcctgcagttg
cttgaagtgccaccggccatggacgccgtccagggcgtggtcatggagctcgacgattgc
gccttcccgctggtcgccgggctgcaggccaccgaccaggccgaggaggcgttcaaggac
gccgactacattctgctggtgggcgccaagccacgcggcccggggatggagcgcaaggac
ctgcttgaggccaatgcggccatcttctcggcgcagggcaaggccatgaacgacgtggca
agccgcaatgtgcgcgtgctcgcggtcggtaacccggccaacacgaacgcgctcatcgcc
cagcgcaacgcccccgacctcgatccgaactgctttaccgcgatgacgcggcttgaccat
aaccgggcgctggcgcagctggcgaaccgcacgggacagcacgttaccgatatccagcag
ctcacgatctggggcaaccactcggcaacgcagtatccggacatcagccatgcgcaggtg
gacggcaaggcagcgagcgacctggtagaccagagctggctggaagagagcttcatcccc
accgtgcagcagcgcggcgcggcgatcatcaaggcgcgaggccagtccagtgcggcctcg
gcggccagtgccgccattgatcacatgcgcgactggacactgggcacgccccagggcgac
tgggtgagcatggcgatcccgtcagatggcagctacggcattgccgagggaattatctat
tccttcccggtccgttgtgccaatggccagtaccagatcgtgcagggcctcgacatcagc
gacttttcccgggagcgcatgagcgccaccgagcaggagctgattgaagagcgcgacgcg
gtagagcacctcctgccctaa

DBGET integrated database retrieval system