KEGG   Sphingomonas sanxanigenens: NX02_00755Help
Entry
NX02_00755        CDS       T03929                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssan00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NX02_00755
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NX02_00755
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NX02_00755
Enzymes [BR:ssan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NX02_00755
Peptidoglycan biosynthesis and degradation proteins [BR:ssan01011]
 Precursor biosynthesis
  Amino acid ligase
   NX02_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
152463..153389
Genome map
AA seq 308 aa AA seqDB search
MHIAVLMGGWSSEREVSLMSGNGVADALESRGHRVTRIDMGHDVAEKLAAAAPDVVFNAL
HGTPGEDGTIQGLLDLMGLTYTHSGLATSVIAIDKQLTKMVLAPHGVRMPGGHVVTSESL
YLGDPLPRPYVLKPINEGSSVGVAIVTAGGNYGDPIGRDTVGPWNAFESLLAEPFIRGRE
LTTAVLDDRALAVTELKPKSGFYDYESKYTDGLTEHVCPANIPEEIAAACLDMALKAHRV
LGCKGTSRADFRWDDERGVDGLYLLEVNTQPGMTPLSLVPEQARFIGMDYASLCEAIVRE
ALAGKGER
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgcacatcgcggttctgatgggcggctggtcgtccgaacgcgaggtttcgctgatgagc
ggcaacggcgtggcggacgcgctggagagccgtggccaccgcgttacccgcatcgacatg
ggccatgacgtcgccgagaagctcgccgccgccgcgcccgacgtcgtgttcaacgcgctg
cacggcaccccgggcgaggacggcacgatccagggcctgctcgacctgatggggctcacc
tacacccattccggcctcgccacgtcggtgatcgcgatcgacaagcagctcaccaagatg
gtgctggcgccgcacggcgtgcgcatgccgggcggccatgtcgtgacgtcggagagcctg
tatctcggcgatccgctgccgcggccctatgtgctcaagccgatcaacgaaggctcgtcc
gtgggcgtcgccatcgtcaccgccggcggcaattatggcgatccgatcggccgcgacacc
gtcgggccgtggaacgcgttcgaaagcctgctggccgagcccttcatccgcggccgcgaa
ctgaccaccgcggtgctcgacgatcgcgcgctggcggtgaccgagctcaagcccaagagc
ggcttctacgactatgagtccaaatataccgacgggctgaccgagcatgtctgcccggcg
aacatcccggaggagatcgccgcggcctgccttgacatggcgctgaaggcgcatcgggtg
ctgggctgcaagggcaccagccgcgccgacttccgctgggacgacgagcgcggcgtggac
gggctctacctgcttgaggtcaacacacagccggggatgacgccgctcagcctggtgccc
gaacaggcccggttcatcggcatggactatgcgtcgctgtgcgaggcgatcgtacgggaa
gcgctggcgggcaagggggaacgatga

DBGET integrated database retrieval system