KEGG   Sus scrofa (pig): 100154319Help
Entry
100154319         CDS       T01009                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04146  Peroxisome
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100154319 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100154319 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100154319 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100154319 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100154319 (SOD2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100154319 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100154319
NCBI-ProteinID: NP_999292
Ensembl: ENSSSCG00000029876
Vega: OTTSUSG00000001720
LinkDB All DBs
Position
1
AA seq 222 aa AA seqDB search
MLCRAACSSSRNLVPALGVLGSRQKHTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVVEEKYQEALKKGDVTAQVALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLVPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYAACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgcagggcggcgtgcagctcgagcaggaatctggtgccggctttgggggtcctg
ggttcccggcagaagcacaccctccccgacctgccgtacgactatggcgccctggagccg
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcgtggaggagaagtaccaggaggcgctgaaaaagggtgatgttacagct
caggtagctctgcagcctgcattgaagttcaacggtggaggccacatcaatcatagcatt
ttctggacaaatctgagccctaacggtggcggggaacccaaaggggaattgctggaagcc
atcaaacgcgactttggttccttcgaaaaattcaaggagaagttgaccgctgtatccgtc
ggcgtccaaggctcaggctggggttggctcggtttcaacaaggaacagggccgcttgcag
attgccgcttgttctaaccaggatcccctgcaaggaacaacaggtctggttccgctgctg
gggatcgacgtgtgggagcatgcgtattaccttcagtataaaaacgtcagacctgattac
ctgaaagctatttggaatgtaatcaactgggagaatgtaactgagcgatacgccgcttgc
aaaaagtaa

DBGET integrated database retrieval system