KEGG   Sus scrofa (pig): 100158154Help
Entry
100158154         CDS       T01009                                 

Gene name
PKM, PK-S
Definition
pyruvate kinase, muscle
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Type II diabetes mellitus
Viral carcinogenesis
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:ssc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssc00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ssc00230]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ssc05203]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:ssc04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
LinkDB All DBs
Position
7
AA seq 531 aa AA seqDB search
MPKPHSDAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENVLWLDYKNICKVVDVGSKVYVDDGL
ISLLVKQKGPDFLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQE
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagccccacagtgatgccgggaccgccttcattcagacccagcagctgcacgcg
gccatggctgacacgttcctggagcacatgtgccgcctggacattgactcgccacccatc
acggcccggaacaccggcatcatctgtaccatcggcccagcttcccgatcagtggagaca
ctgaaggagatgattaagtctggaatgaacgtggctcgtttgaacttctctcacggaact
catgagtaccatgcagagaccatcaagaacgtgcgtgcggctacagaaagctttgcttca
gatcccattctctaccggccagtggctgtggccctggacactaaaggacctgagatccga
accgggctcatcaagggcagcggcactgctgaggtggagctcaagaaaggagccacgctc
aagatcaccctggataatgcctacatggaaaagtgtgacgagaatgtcctgtggctggac
tataagaacatctgcaaggtggtggatgtgggcagcaaggtctacgtggatgatggactt
atttctttgctggtgaagcagaaaggtcctgacttcctggtgacggaggtggagaacggc
ggcttcctgggcagcaagaaaggtgtgaaccttcctggagctgctgtggacctgcctgcc
gtgtccgagaaggacatccaggatctgaagtttggggtggagcaggacgtggatatggtg
ttcgcatctttcatccgtaaggcggccgacgtccatgaagtcaggaaggtcctgggagag
aaaggaaagaacatcaagataatcagcaaaatcgagaatcacgagggagttcggagattt
gatgagatcctagaagccagcgatggtatcatggtggctcgtggtgatctaggcattgag
attcctgcagagaaggtcttccttgcccagaagatgatgattgggcggtgcaaccgagct
gggaagcctgtcatctgtgccacgcagatgctggagagcatgatcaagaagccccgtccc
acccgggctgagggcagtgatgtggccaatgcagtcttggatggagctgactgcatcatg
ctgtctggagagacggccaaaggggactaccccctggaggctgttcgcatgcagcacctg
attgcccgtgaggcagaggccgccatctaccatttgcaattatttgaggagctccgccgc
ctggcgcccattaccagcgaccctaccgaagctgccgccgtgggcgccgtggaggcctcc
ttcaagtgctgcagtggggccataatcgtcctcaccaagtctggcaggtctgcacatcag
gtggctaggtaccgcccccgagcccccatcattgctgtgacccggaatcaccagacagct
cgccaggcccacctgtaccgcggcatcttccccgtggtgtgtaaggacccagtgcaggag
gcctgggccgaggacgtggacctccgggtgaacttggccatgaatgttggcaaagcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccgggtggcgccctggttccggc
ttcaccaacaccatgcgcgtagtgcctgtgccgtga

DBGET integrated database retrieval system