KEGG   Sus scrofa (pig): 100738467Help
Entry
100738467         CDS       T01009                                 

Gene name
NEU2
Definition
(RefSeq) sialidase-2
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
ssc  Sus scrofa (pig)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100738467 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100738467 (NEU2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100738467 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
15
AA seq 379 aa AA seqDB search
MASCPVLHKETVFQTGAHAYRIPALLYLPQQKTLLAFAEKRASKKDEHAKLIVLRRGSYD
ASTRQVRWHPQEAVAQAQLEGHRSMNPSPLYDKKTGTLFLFFIAIPGQVSEHHQLQTRVN
LTRLCQVTSTDHGRSWSPARDLTDSVIGPAHKDWATFAVGPGHCLQLHNQTQSLLVPAYA
YRNLPFPRAPAPSAFCLVSHDHGHTWARGSFVALDTLECQVAEVGDAEQRVVYLNARSRL
QARVQAQSTNGGLDFGETQPVKQLVEPPHGCQGSIISFPSPRGGPDSPHQWLLYTHPTDP
KRRSNLGVYLNRQAPAPLAWSEPALLATGSCAYSDLQSMGAGPDGSPQFGCLYESNDYEE
IVFVMFTLKQAFPAAFLLQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctgccccgtcctgcacaaggagactgtgttccagaccggagcccacgcctac
agaatccccgctctgctctacttgcctcagcagaagaccctgctggcctttgcggagaag
cgggcgagcaagaaggacgagcacgcgaagctgattgtcctgcgcaggggaagctacgat
gcgtccacccgccaggtccggtggcacccgcaggaggcggtggcccaagcccagctggag
ggccaccggtccatgaaccccagccccctgtatgacaagaagacggggacccttttcctc
ttcttcattgccatccccgggcaggtgtctgagcaccaccagctccagaccagggtcaac
ttgacacggctgtgccaggtcaccagcacagaccatgggaggtcctggagccccgccaga
gacctcacggactccgtcattggcccggcccacaaggactgggccactttcgcggtgggc
ccgggccactgcctgcagctgcacaaccagacgcagagcctgctggtgccagcctacgct
taccgcaacctcccctttccgcgggcacccgccccctccgccttctgcttggtcagccat
gaccacgggcacacgtgggcacgaggcagcttcgtggccctggacaccctggagtgccag
gtggccgaagtcggagatgcagaacagagggtggtgtatctgaacgcgaggagccgcctc
caagccagggtccaggcccagagcaccaacggcgggctcgatttcggggagacccagcca
gtaaagcagctcgtggagcctccgcacggctgccaggggagcatcatcagcttccccagc
ccccgaggggggccggactccccacaccagtggctgctctacacccacccgactgacccg
aagcgaagatccaacctgggcgtgtacctgaaccgacaggcccccgcgcccttggcctgg
tcagagcccgccctgctggccacgggcagctgcgcttactcagacctccagagcatgggc
gccggccccgacgggtcaccccagtttgggtgtctgtatgaatcaaatgattatgaggag
attgtctttgtcatgttcaccctgaaacaagccttcccagctgcatttttgctgcaatga

DBGET integrated database retrieval system