KEGG   Sus scrofa (pig): 397500Help
Entry
397500            CDS       T01009                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00250  Alanine, aspartate and glutamate metabolism
ssc00280  Valine, leucine and isoleucine degradation
ssc00410  beta-Alanine metabolism
ssc00640  Propanoate metabolism
ssc00650  Butanoate metabolism
ssc01100  Metabolic pathways
ssc04727  GABAergic synapse
Module
ssc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    397500 (ABAT)
   00650 Butanoate metabolism
    397500 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    397500 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    397500 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    397500 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    397500 (ABAT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     397500 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     397500 (ABAT)
Amino acid related enzymes [BR:ssc01007]
 Aminotransferase (transaminase)
  Class III
   397500 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Aminotran_1_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 397500
NCBI-ProteinID: NP_999428
Ensembl: ENSSSCG00000007909
UniProt: P80147
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3
AA seq 500 aa AA seqDB search
MASVLLTRRLACSFRHNHRLLVPGWRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQ
NVSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSAFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLNSIARNKGVMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtgttgctcacccggaggctggcctgcagcttccgccacaaccaccgcctg
ctggtgcccggatggagacacatcagtcaggccgcagccaaagtggacgttgaatttgat
tatgacgggcctttgatgaagacggaagtcccagggcccagatctcgggagttaatgaaa
cagctgaatataattcagaacgcagaggctgtgcactttttctgcaattacgaagagagc
cgaggcaattacctggtggacgtggacggcaaccggatgttggatctttactcccagatc
tcctccatccccataggttacagccatcctgctctcgtgaaactcgtccaacagcctcag
aatgtgagtacattcattaacagacctgccctcggaatccttcctccggagaacttcgtg
gagaagctgcgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcaca
atggcctgcggctcctgttccaatgaaaatgcgttcaagaccatctttatgtggtaccgg
agcaaggaaaggggccagtcggctttctccaaagaggagctggagacgtgcatgatcaac
caggcccccgggtgccccgactacagcatcctctccttcatgggtgccttccacgggagg
accatgggttgcttagcgaccacgcactccaaagccattcacaagatcgacatcccttcc
ttcgactggcccatcgcaccattcccgcggctgaagtatcctctggaggagtttgtgaaa
gagaaccaacaagaagaggcccgctgtctggaagaggtggaggacctgattgtgaaatac
cggaagaagaagaagacggtggccggcatcatcgtggagcccatccagtctgagggcggg
gacaaccatgcgtccgacgacttcttccggaagctgcgggacatctccaggaagcacggc
tgtgccttcttggtggatgaggtccagacaggaggaggctccaccggcaagttctgggcc
cacgagcactggggcttggacgacccggccgatgtgatgaccttcagcaagaagatgatg
acggggggcttcttccacaaggaggagttcagacccaacgctccctaccggatcttcaac
acgtggctgggggacccttccaagaacctgctgctggccgaggtcatcaacatcatcaag
cgggaggacctgctgagcaacgcagcccacgccgggaaggtcctgctcacggggctgctg
gacctccaggcccggtacccccagttcatcagcagagtgagaggacgaggcactttttgt
tccttcgacaccccagacgaatccatacggaataaactcaattccatcgccagaaacaaa
ggtgtgatgctggggggctgtggcgacaaatccatccgcttccgtcccactctggtcttc
agggatcaccacgcacacctgttcctcaatattttcagcgacatcttagccgacttcaag
taa

DBGET integrated database retrieval system