KEGG   Staphylococcus schleiferi 2317-03: RN70_03770Help
Entry
RN70_03770        CDS       T04520                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sscz  Staphylococcus schleiferi 2317-03
Pathway
sscz00010  Glycolysis / Gluconeogenesis
sscz00053  Ascorbate and aldarate metabolism
sscz00071  Fatty acid degradation
sscz00280  Valine, leucine and isoleucine degradation
sscz00310  Lysine degradation
sscz00330  Arginine and proline metabolism
sscz00340  Histidine metabolism
sscz00380  Tryptophan metabolism
sscz00410  beta-Alanine metabolism
sscz00561  Glycerolipid metabolism
sscz00620  Pyruvate metabolism
sscz00625  Chloroalkane and chloroalkene degradation
sscz01100  Metabolic pathways
sscz01110  Biosynthesis of secondary metabolites
sscz01120  Microbial metabolism in diverse environments
sscz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sscz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RN70_03770
   00053 Ascorbate and aldarate metabolism
    RN70_03770
   00620 Pyruvate metabolism
    RN70_03770
  Lipid metabolism
   00071 Fatty acid degradation
    RN70_03770
   00561 Glycerolipid metabolism
    RN70_03770
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RN70_03770
   00310 Lysine degradation
    RN70_03770
   00330 Arginine and proline metabolism
    RN70_03770
   00340 Histidine metabolism
    RN70_03770
   00380 Tryptophan metabolism
    RN70_03770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RN70_03770
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RN70_03770
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RN70_03770
Enzymes [BR:sscz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RN70_03770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AKS73097
LinkDB All DBs
Position
855075..856508
Genome map
AA seq 477 aa AA seqDB search
MRDQTKQYINGEWVESHSGETIDVINPATEEVFGRIAKGDKEDVDRAVQAAHDVYLSFRH
TSVKERQELLARIVEEYKNRKEDIIEAITLELGSPVSKSDKVHYEAGLNHFQAAHDALND
FQFEERRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSELTPFAAI
ILAEIFDKAGVPKGVFNLVNGDGEGVGTPLSQHPDVRMMSFTGSGGTGSKIMEQASKDFK
KVSLELGGKSPYIILDDADIKEAAQAAVKKVVNNTGQVCTAGTRTIIPESIKDQFLVQVK
EEIAKVKVGDPQNTDTEVGPIVSEKQYNQVQDYIQKGIDEGAELLYGGTGKPEGLDQGYF
AKPTIFANVDNKMTIAQEEIFGPVMSVITYKDLDDAIKIANDTKYGLAGYVFGKDKDKLK
QVARSIEAGTVEINESGRKPNLPFGGYKQSGLGREWGDYGVEEFLEVKAIAGYYKGE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagagatcaaacgaaacaatatataaacggtgaatgggttgaaagtcatagtggtgaa
actatagatgtgattaacccagcaactgaagaagtgtttggacgtattgcgaaaggtgac
aaagaagatgttgatcgcgctgtccaagctgcacatgatgtatatttatcattccgtcat
acttcagtaaaagaacgtcaagaattattagcacgtatcgtggaagaatataaaaataga
aaagaagatataattgaagccattactttagaattgggttcaccagtatcaaaatctgat
aaagtgcactatgaagcaggattaaatcacttccaagctgcacatgatgctttaaatgat
ttccaatttgaagaacgtcgtggcgatgatttagttgttaaagaagccattggagttgcg
ggactagtaaccccttggaacttcccaacaaaccaaacatcacttaaacttgctgctgca
tttgctgcgggtagcccagtggtgttaaaaccttctgaattaacaccattcgctgctatt
attttagcagaaatttttgataaagctggcgtacctaaaggcgtattcaaccttgttaac
ggtgatggagaaggcgtaggaactccgttgagtcagcaccctgatgtacgtatgatgtca
tttacaggttctggtggtacaggttctaaaattatggagcaagcaagtaaagactttaaa
aaagtttcacttgaacttggaggtaaatcaccctatattattttagatgatgcagatatt
aaagaagctgcacaagctgctgtgaaaaaggtcgttaataatacgggtcaagtatgtact
gcaggtacacgtacaattatacctgaaagcataaaagatcaatttttagtacaagttaaa
gaagaaattgcaaaagttaaagttggcgacccacaaaatactgacactgaagtgggacca
attgtaagtgaaaaacaatacaatcaagttcaagactatattcaaaaagggattgatgaa
ggtgccgaactattatatggtggcactggcaaacctgaaggattagatcaaggttatttt
gcaaaaccaactatatttgcaaatgttgataacaaaatgacaattgcccaagaagaaatt
tttggtccagttatgtctgtaatcacttataaagatttagacgatgcgattaaaattgca
aatgacacaaaatatggtcttgcaggctatgtttttggtaaagacaaagataaattaaaa
caagttgcacgttctattgaagcaggtactgttgaaattaatgaatctggacgtaaacca
aacttaccatttggtggctataaacaatcaggtttaggtcgtgaatggggagactatggt
gttgaagaatttttagaagttaaagcgattgcaggttattataaaggcgaataa

DBGET integrated database retrieval system