KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0694Help
Entry
SPSINT_0694       CDS       T01396                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPSINT_0694
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPSINT_0694
Enzymes [BR:ssd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPSINT_0694
Bacterial toxins [BR:ssd02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPSINT_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
719882..721333
Genome map
AA seq 483 aa AA seqDB search
MLAFNQEVRAENNPVKDQSIFKSGDTTQANYFRIPALYTLSNGEMIASADARYGGTHDAK
SKINIATSTSFDGKNWTSPTFALQFHDYESQLIDWPRDNVGKNRQIQGSASFIDSAIVQD
KNTNKIFLMADMMPAGIGNNNALKSDSGFKEINGKYYMKLKLNNEKGYNYSIREHGTIFN
DKNNNPTIYSVDRDYNILKNNEYQYVTQYSVKFNGSNLQEYHNNNKVKMNVFYKDSIFKV
TPTNYIVYTTSMDGQKWGHPEILPPFLGLNHNASYLSPGQGLATSTGRLIFASYTSQGLV
FIYSDDHGITWQATKAGLPFKNATAETQMVELKPNVIRAFFRTTTGEIGYITSLDNGHTW
DNVHYLSQINQTRYGTQISVIKYSQKYQGKDVIILSTPNSRTGRNNGQIWIGLVDSKTNN
IDWIHHKQVDEINVGYSYSALTETKDSKILLLYEKYDSWSRNQLHLKNTMKYRVYTFEDL
LSD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttagcttttaatcaagaggttcgagcagaaaataacccggtcaaagatcaaagtatt
ttcaaatcgggcgatacaacccaagcgaattattttagaatccctgcattgtatacgtta
agtaatggagaaatgattgcaagcgctgatgcacgctatggtgggacacatgatgcaaaa
agtaaaattaatatagcgacatctactagttttgatggtaagaactggacatcccctaca
tttgcattacaattccatgattatgaaagtcaattgatagattggccacgtgataatgtt
gggaaaaatagacaaattcaaggaagcgcttcatttattgactcagcaattgtacaagat
aaaaataccaataaaatttttttaatggcagatatgatgccagcgggtattggtaataat
aatgccctaaaaagtgattcaggttttaaagaaattaatggcaaatattacatgaaatta
aagttgaataatgagaaaggctataattattctatccgtgagcatggtacaatatttaat
gataagaataacaatcctaccatttatagtgtagatagagattataatattttaaaaaat
aacgaatatcaatatgtaacgcaatattcagtgaaatttaatggttcaaatttgcaagaa
taccataataataataaggttaaaatgaatgttttctataaagattcgatatttaaagta
acacctacaaattatatcgtttatacgacgagtatggatggacaaaaatggggacaccct
gaaattttaccgccatttttaggattgaatcataatgcatcctatttaagtcctggccaa
ggtctagcaacttctacagggcgtttaatatttgcatcttatacttcgcaaggacttgtt
tttatttatagtgatgatcatggaataacttggcaggcaacaaaagctggtttacctttt
aagaatgcaactgcagaaacgcaaatggtcgaattaaagccaaatgtgattagagctttt
ttcagaactacaactggggaaataggctatattacgagtttagacaatggtcatacatgg
gacaacgtgcattatttaagtcaaatcaatcaaactcgatatggtacacaaatttctgta
ataaagtattcacagaaataccaaggaaaagatgttattattctcagcaccccaaattca
agaacaggaagaaataatgggcaaatatggataggtttagtagatagtaaaacaaataat
attgactggattcatcataaacaagttgatgaaatcaatgtgggttattcttattcagca
ttaaccgagacaaaggattcgaaaattttattattatacgaaaagtatgattcttggtct
agaaatcaactgcatttaaaaaatactatgaaataccgtgtttatacatttgaggatttg
ttatccgattag

DBGET integrated database retrieval system