KEGG   Streptococcus suis A7: SSUA7_0867Help
Entry
SSUA7_0867        CDS       T02020                                 

Definition
(GenBank) neuraminidase B
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ssf  Streptococcus suis A7
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SSUA7_0867
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSUA7_0867
Enzymes [BR:ssf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SSUA7_0867
Bacterial toxins [BR:ssf02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SSUA7_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(907036..909132)
Genome map
AA seq 698 aa AA seqDB search
MKNNKLISMFGIILLSTTLLTSVSTIVVQSEESNISVVENSNEFHSGNYVLNNKGIDITS
EAFDKISGETQSVVLKFKSNTPNQLQALFGASNSKAGFRNNYFSIFMRDTGELGIEVRDQ
QRGINYLFSRPASIWGIHKGEPVENTVVFIADSTAKTYTVYVNGTKIISETVNNFLPISG
IGGLDNVSVGSVNREGRDAYTMNGQVSQLSIYNRILSDEEIQGKVGQLPYSYIFRSGDAT
NANYFRIPTLYTLSNGRVLSSIDARYGGTHDSKSKINIATSYSDDNGQNWSTPQLTLKFD
DYAEELLTWPRATGLRDAQINGSASFIDSALVEDRTTGNVIMLADAMPFGIGNGNANRND
SGYKEIEGKYYLKLKKEGDADYNYSVREDGVIYEDTGNTPTNYRLNDRYEVFEADKPLTV
EQYSVSYDNGSLQEFHNGKHVPMNVFYKDSLFKVARTNYLGYTISKDKGETWSNFKLFPP
FLGINHNAPYFSPGQGLSLSNSSRTIFATYTRGELTYLITDDGGLNWKKSSAPVPFKNAT
AEAQMVELREGVIRTFFRTTTGKIAYMTSYDSGESWSDVFYLDHIVQTNYGTQVTAIKYS
KKIDGKDAIILSTPNNSSGRRTGQIWIGLINSDDTVEWKYSYNVDLPKFGYSYSAITELP
NGHLGLLFEKYDSWSRNELHLSDVVQYVDLEISDIINN
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataataagttaatttcaatgtttggtattatccttttatcaactacattatta
acatctgtttcgacaatagttgttcaatcagaagaaagtaatatttcagtggtggaaaat
tcaaatgaattccattctggtaattatgttttaaacaataaaggtatagacattacttct
gaggcatttgataaaattagtggagaaactcagagtgtagtcttaaaatttaaatcgaac
acaccaaatcaattacaagctctattcggagcatctaatagtaaagcaggttttagaaat
aattatttctcaatatttatgagagataccggagagcttggaatagaggttcgagatcaa
caaagaggcattaattatctatttagccgcccagcgtcaatttggggaatacataaagga
gagccagttgaaaatacagttgtatttatagctgattcaactgcaaagacatatacagtt
tatgtgaatggtacgaaaattatttcagagactgttaataattttcttccaatttcaggt
attgggggacttgataatgtaagtgttggtagcgtgaatagagaaggacgcgatgcatat
actatgaacggtcaagttagccagctttcaatctataatcgtatattatctgatgaagaa
attcagggtaaggttggtcagttaccgtatagttacatttttagatctggtgatgctact
aatgccaattacttccgtattccaacattgtatacattgagtaatgggagagtattatca
agtattgatgctagatatggtggcacacatgattctaaaagcaagattaatattgctacc
tcgtatagtgatgataacgggcagaattggtcgactccacaattgacattgaaatttgat
gattatgctgaggagctattgacttggccaagagcgacaggcttaagagacgcacaaata
aatggtagtgcatcatttattgactctgctttagtagaagaccggacaactggcaatgta
attatgttagcagatgctatgccgtttggcattggaaatggaaacgctaatcggaacgac
tcaggatataaagagattgaaggtaaatattacctgaaattgaaaaaagagggagatgca
gactataattattcggttcgtgaagacggtgttatttatgaggatactgggaatacaccg
acaaattatagattaaacgacagatatgaagtttttgaagcagataagccattaacggta
gaacagtactctgttagttacgataatggtagcttgcaagagtttcataatggcaagcat
gttcctatgaatgtgttttataaggattctttatttaaagtagcaagaacgaattactta
ggttacaccattagtaaagataaaggcgaaacctggagcaactttaaattgtttcctccg
ttcttaggaattaatcataacgcgccatactttagtccaggacaaggattatcgctatca
aacagtagtcgtacaatatttgccacctatactcgtggtgagttaacatacttaattact
gatgatggagggttaaactggaaaaaatcttctgcaccagttcctttcaaaaacgcaact
gctgaagcacagatggtcgaacttagagaaggtgtgattcgtacattctttagaacaaca
actggcaaaattgcttatatgacaagctatgattcaggagaatcatggtcggatgtattc
tacttagatcatattgttcaaacaaactatggaactcaagtaacagcaattaaatattct
aaaaaaattgatggaaaagatgcaattattctgtcaacaccaaataattcttctggtcgt
agaactggtcaaatttggataggcttgattaatagtgatgatactgtagagtggaagtat
tcttacaatgttgatttaccaaaatttggttattcatattcagcaattacagaattacca
aacggccatctagggttattatttgaaaaatatgattcatggtcaagaaatgagttgcat
ttgtcggatgtagtgcagtatgtagatttagaaatttcagatatcattaataattaa

DBGET integrated database retrieval system