KEGG   Streptomyces silaceus: A7J05_05430Help
Entry
A7J05_05430       CDS       T05110                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
ssia  Streptomyces silaceus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: APY85239
UniProt: A0A1P8TC79
LinkDB All DBs
Position
1426680..1427783
Genome map
AA seq 367 aa AA seqDB search
MDLPVMPPVKPMLAKPVATIPPGMQYEAKWDGFRAIVFRDRGELEIGSRTGKPLTRYFPE
LVAALRERLPARCVLDGEVVIARDGHLDFDALSERIHPAASRVATLAERTPASFVAFDVL
ALGDEALLDTRMDDRRARLVEALDGVTPPVHVAPATTDVDVARRWFDQFEGAGLDGVIAK
PLDLRYRQNERSMFKIKHERTADCVVAGYRFHKSGPVVGSLLLGLYDDHGALQHVGVAAA
FSMARRAELIDELEPLRLESAADHPWAAWGDEAAHEGARMPGAPSRWTGKKDLSWVPLRP
ERVCEVAYDHMENGQRFRHTARFRAWRPDREAESCTYAQLEEPVSYSLEDVLGGPGPGAQ
RRNHANL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatctccccgtgatgccacccgtgaagcccatgctcgccaagcccgtggcgacgatt
cccccgggcatgcagtacgaggccaagtgggacgggttccgggccatcgtcttccgggac
cggggtgagctggagatcggcagccggacggggaagccgctcacccggtacttccccgag
ctggtggcggccctgcgggagcggctgcccgcgcgctgcgtgctggacggcgaggtcgtg
atcgcgcgggacgggcacctcgacttcgacgcgctcagcgaacgcatccacccggcggcc
tcgcgcgtcgcgacgctcgccgagcgcacgcccgcctccttcgtcgccttcgacgtcctg
gcgctgggcgacgaggcgctgctcgacacccgtatggacgaccgccgcgcccgcctggtg
gaggcgctggacggggtgacgccgccggtccacgtggcgccggcgaccacggacgtcgac
gtggcgcggcgctggttcgaccagttcgagggcgcgggcctggacggcgtgatcgccaag
ccgctcgatctgcgctaccgccagaacgagcgctccatgttcaagatcaagcatgagcgc
acggcggactgcgtggtcgccggctaccgcttccacaagagcgggcccgtcgtcggctcg
ctcctcctcggcctctacgacgaccacggcgccctgcagcacgtgggcgtcgccgccgcg
ttctccatggcgcggcgggcggagctgatcgacgagctggagccgctgcgcctggagtcc
gccgcggaccacccctgggcggcctggggcgacgaggcggcgcacgagggggcgcggatg
ccgggcgcgccgagccgctggacgggcaagaaggacctgtcgtgggtgccgctgcgcccc
gagcgggtctgcgaggtcgcgtacgaccacatggagaacggacagcgcttccgccacacg
gcgagattccgcgcctggcgccccgaccgcgaggcggagagctgcacctacgcccaactg
gaggagccggtctcgtactccctggaggacgtgctcggcggccccgggccgggcgctcag
cgccgcaatcacgccaacctgtga

DBGET integrated database retrieval system