KEGG   Streptomyces silaceus: A7J05_09360Help
Entry
A7J05_09360       CDS       T05110                                 

Definition
(GenBank) glycosyl transferase
Organism
ssia  Streptomyces silaceus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2341325..2342569
Genome map
AA seq 414 aa AA seqDB search
MHVLVVHNRYSSAQPSGENRVVDEEVALLRAAGHRVEVFERRSDDIAARSLLAKAAVPLL
VPWNPAVRRELTARLRAERPDVVHVHNVFPLLSPAVLAACADAGVPVVATLHNYTQVCPP
GTLHRDGGRCTECVGSKASLPAVRHGCYRDSRLATVPLAVSLTVNRRRWWSGVERFFCIS
AAQRDVLVRSGMPPERLMVKHNFVPDAGPRRTGPGEHLLFLGRLAEAKGVRLLMTAWDEI
AARGGVGVPLALVGAGPLEREVAAWAAGRDDVRHLGLYDPARCRQAVARSVAMVAPSMAM
ETFGLVVAEAMAAGVPSVAAGHGAFVELVEDGVSGLLHRPGDAASLASRIRRITGDPARN
QEMGQAARRRYEQGFSPAVGLERLVEGYRTAIAGRSALARGGDTRASRGDGDSR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcctcgtggtgcacaaccgctactcatcggcgcagccgagcggcgagaaccgg
gtcgtcgacgaagaggtggccctgctgcgcgcggcaggccaccgggtcgaggtgttcgag
cggcgcagcgacgacatcgccgcgcggtccctgctcgccaaggccgcggtgccgctcctg
gtgccgtggaacccggcggtccgcagggagctcaccgcccggctccgcgccgagcggccc
gacgtggtgcacgtccacaacgtcttcccgctcctgtccccggcggtgctcgcggcctgc
gccgacgccggtgtgcccgtcgtcgccacgctgcacaactacacccaggtctgcccgccc
ggcacgctgcaccgcgacggcggccgctgcaccgagtgcgtcgggtcgaaggcgtcgctg
cccgccgtccggcacggctgctaccgcgactcccggctcgcgacggtgccgctcgcggtc
agcctgacggtcaaccggcggcgctggtggtccggggtggagcggttcttctgcatctcc
gcggcgcagcgcgacgtgctggtgcggtcgggcatgccgcccgagcggctgatggtgaag
cacaacttcgtgcccgacgcgggccctcgccggacgggccccggcgagcatctgctcttc
ctcggccggctcgcggaggccaagggcgtgcggctgctcatgacggcgtgggacgagatc
gccgcgcggggcggcgtgggcgtgccgctcgcgctcgtcggcgcggggccgctggagcgg
gaggtggcggcctgggcggcgggccgggacgacgtgcgccacctcggcctgtacgacccg
gcgcggtgccggcaggccgtcgcgcggtcggtcgccatggtggctccgtcgatggcgatg
gagacgttcggcctggtggtcgcggaggcgatggcggcgggggtgccgtccgtcgccgcc
ggtcacggcgccttcgtcgagctcgtcgaggacggcgtgagcgggctgctgcaccggccg
ggcgatgccgcctcgctggcgtcccggatacgccggatcacgggcgacccggcccgcaac
caggagatgggccaggcggcccggcgccgctacgagcagggcttcagcccggccgtcggt
ctcgaacgcctggtggagggataccgcaccgcgatcgcgggtcggtcagcactggctcgc
ggcggggacacgcgcgcgagcaggggggatggggacagcagatga

DBGET integrated database retrieval system