KEGG   Streptococcus salivarius CCHSS3: SALIVB_1062Help
Entry
SALIVB_1062       CDS       T01580                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (Acetoin dehydrogenase E2 component) (Dihydrolipoamide acetyltransferase component of acetoin cleaving system)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00010  Glycolysis / Gluconeogenesis
ssr00020  Citrate cycle (TCA cycle)
ssr00620  Pyruvate metabolism
ssr01100  Metabolic pathways
ssr01110  Biosynthesis of secondary metabolites
ssr01120  Microbial metabolism in diverse environments
ssr01130  Biosynthesis of antibiotics
ssr01200  Carbon metabolism
Module
ssr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_1062 (acoC)
   00020 Citrate cycle (TCA cycle)
    SALIVB_1062 (acoC)
   00620 Pyruvate metabolism
    SALIVB_1062 (acoC)
Enzymes [BR:ssr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SALIVB_1062 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCB93351
UniProt: F8LJ31
LinkDB All DBs
Position
complement(1160933..1162321)
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAEGEVVADNAASAPAAEPAPKVEEVAAVAEPVVAAQTQAPIVH
EGGKVRATPKARKVARELGIDLAQVPGTGAKGRVHADDVENFKGAQPKATPLARKIAADL
GIDLASVSGTGFGGKITKEDILAISAPAQVKEAAAAPVVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLMALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLIDDAQNIELHKFVNLGIAVGLDDGLIVPVVHGADKMSLSEFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLIENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagcttggtgttgatatgcaggaaggcgaaatcatc
gagtggaagaaacaagagggtgatgtggttaatgagggagatatccttcttgaaatcatg
tcagataagacgaacatggaacttgaagcagaagattctggtgttcttttgaagattacc
cgtcaggctggtgaaactgtaccagttactgaggttattggttatattggagcagaaggt
gaagtggtagctgacaacgcagctagcgcgccagctgctgaacctgcgccaaaagttgaa
gaagttgccgctgtagcagagcctgtagtggcagcgcaaacgcaagcacctatcgttcac
gaaggcggcaaagtacgtgcaacacctaaggctcgtaaggtggcgcgtgagttggggatt
gacctcgctcaagtaccaggaactggagcaaaaggtcgtgttcatgctgatgacgttgaa
aactttaagggtgctcaacctaaggcgactccattggcacgtaagattgcagcggatctt
ggtattgacttagctagcgtatctggaacaggctttggtggtaagattactaaggaagat
atccttgcaatcagtgctccagcgcaagttaaggaagcggctgctgcacctgtggttgaa
gctaaacctgaaaaagtcttgccagaaggcgtggaagttatcccaatgtctgctatgcgt
aaggcgatttctaagggaatgacgcactcatacttgactgcgccaacctttactcttaac
tatgacgtggacatgactaaccttatggctcttcggaagcaagtccttgatccaatcatg
aataagactggtatgaaggtaaccttcacggatttgattggtttggcagttgttcgtact
cttatgaaagaggaacaccgttacctcaatgcatccttgattgacgatgcccaaaatatc
gaattacacaaatttgttaatctcggtattgccgttggtctcgatgatggcttgattgta
cctgtcgttcacggtgcagataagatgagtttgtctgagtttgttgtggcttctaaggat
gtcatcaagaaagctcaggctggtaaattgaaggctgcagaaatgtcaggttcaaccttc
tctattactaacttgggaatgtttggaactaagtcatttaacccaatcatcaaccaacca
aactcagctatcctaggtgtttcagcaactattcagactccagttgtagttgatggagaa
gttgtcgtacgtccaatcatgggtctatgcttgacaattgaccaccgtattgtagatggt
atgaatggtgccaaattcatggttgatttgaaacatttgattgaaaatcctatggaattg
ttgatttaa

DBGET integrated database retrieval system