Streptococcus suis 05ZYH33 (serotype 2): SSU05_0842 Help Entry SSU05_0842        CDS       T00514                                  Name (GenBank) Uncharacterized protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ssu  Streptococcus suis 05ZYH33 (serotype 2) Pathway ssu00362   Benzoate degradation ssu01100   Metabolic pathways ssu01120   Microbial metabolism in diverse environments ssu01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ssu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SSU05_0842    00622 Xylene degradation     SSU05_0842    00621 Dioxin degradation     SSU05_0842 Enzymes [BR:ssu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      SSU05_0842 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF1904 Motif Other DBs NCBI-ProteinID:  ABP89808 LinkDB All DBs Position complement(819171..819353) Genome browser AA seq 60 aa AA seqDB search MPFVRIDLFEGRTEEQKIALAREVTEVVSRNTNAPKEAIHVFINDMPEGTYYPQGEMKRK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgccatttgtacgtattgatttgtttgaaggacgcacagaagaacaaaaaattgccctt gcgcgtgaagtaactgaggtggtatcacgcaatactaatgcgcccaaagaagccattcat gtcttcatcaatgatatgcctgaagggacctactacccacaaggtgaaatgaaacgtaaa taa

DBGET integrated database retrieval system