KEGG   Streptococcus suis GZ1: SSGZ1_1633Help
Entry
SSGZ1_1633        CDS       T02023                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ssw  Streptococcus suis GZ1
Pathway
ssw00473  D-Alanine metabolism
ssw01100  Metabolic pathways
ssw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSGZ1_1633
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SSGZ1_1633
Enzymes [BR:ssw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SSGZ1_1633
Peptidoglycan biosynthesis and degradation proteins [BR:ssw01011]
 Precursor biosynthesis
  Racemase
   SSGZ1_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADE32089
UniProt: D5AJS4
LinkDB All DBs
Position
complement(1653932..1655035)
Genome map
AA seq 367 aa AA seqDB search
MIESEHRPTQIRVNLDAIAENFEQVMTNLPPKTEAFAVVKANAYGHGAVAVAKKLSSQAA
GFCVSNLDEALELRKAGIEHPILILGVVPVRFLPVAHQLNISVTVASLDWLQDAKGLEAD
LSGLTVHLKLDTGMGRIGFRKIADLLQAIAILEELEYDIEGVYTHFATADEVDQAHFESQ
LSVFKEFLDVLPITPRWIHASNSATSIWHADTVFNLVRLGNILYGLNPSGRVLELPFDVQ
PALSLVSEIVHVKQVEAGTTIGYGATYHSTDSEWIATVPIGYADGLVRSLQGLSVLVDGQ
ACEIVGRISMDQITIRLPHAYPLGQKVTLIGQDGDKTISVQEWADRIGTINYEVVCLLTD
RLPRIFG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaagtgaacatcgacccacgcaaattcgggttaacttagatgcgattgcggaa
aatttcgagcaagtaatgactaacttgccccctaagaccgaagcatttgctgtcgttaag
gcgaatgcttatggtcatggagctgttgcggtagcaaaaaagttatccagtcaagcagct
ggtttttgtgtttcgaatttggatgaagcattagagttacgtaaagcgggtatcgagcat
cctatcttgattttaggagtggttcctgtacgttttttaccagtagctcatcaactcaat
atcagtgtgacagttgctagtctggactggttgcaagatgcaaaaggcttagaggctgat
ttatctggtctaactgttcatcttaagctggatacaggtatggggcggattggttttaga
aaaatagctgatttgctacaagcgattgctatccttgaagaattagagtatgacatcgaa
ggagtctatactcattttgctactgcggatgaggttgatcaggcgcacttcgagagtcaa
ctgtctgtttttaaagaatttttggatgttctaccaattactccgcgctggattcatgcc
agcaattcagcaacaagcatttggcatgctgatacagtatttaacctggttcgtttggga
aacattctttatggacttaatccaagtggacgagtgctagaactcccgtttgatgttcaa
ccagccttatctctcgtatctgaaattgttcatgtaaagcaggttgaagctggcacaaca
attggctacggagctacttatcacagcaccgattcagaatggattgcgaccgttccgata
ggatatgcagatggtctcgtacgaagcttacaaggcttatcagtcctagtcgatgggcag
gcctgtgaaattgtagggcgtatttcgatggaccagatcaccattcgcttacctcatgct
tatccacttggtcaaaaagtcaccctaatcggtcaagatggagataaaacaatctctgtt
caggagtgggctgatcgcatcggaaccataaattacgaggtggtttgtcttttgacagat
cgcctacctcgaatttttgggtaa

DBGET integrated database retrieval system