KEGG   Streptomyces sp. SirexAA-E: SACTE_3073Help
Entry
SACTE_3073        CDS       T01601                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SACTE_3073
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SACTE_3073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3433899..3435086)
Genome map
AA seq 395 aa AA seqDB search
MSDLKERAQALDSADALAPCRELFTLDDTVYLDGNSLGALPRHVPDRMRDVLARQWGELR
IRSWDESGWWTAPERIGDRIAPLVGAAPGRIVVGDSTSVNVFKAVVAASRLAPGDRDEIV
LDATTFPSDGYIAESAARMTGHRLVVADPSDVPAALGPRTALVLLNHVDYRTGRLQDLPG
LTAAAHAAGALAVWDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPGSPAFLYVAERHQ
AAFDSPLPGWTSHADPFAMDLGYTPAEGSVRGRVGTPDILSMLALEASLDVWDGVTMEAV
RAKSLALTDFFLECVEAYVPEGRVTSVTPAAHAERGSQVSLRCEGAAEVMGALIARGVVG
DLRRPDILRFGFTPLYVGFADAERAARVLAEVLEA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgaaggagcgcgcacaggcgctcgactccgccgacgcactggccccgtgc
cgggagctgttcaccctcgacgacaccgtctacctggacggcaattcgctgggcgcgctg
ccccgccacgttcccgaccgcatgcgggacgtcctcgcccgccagtggggcgaactgcgc
atccgctcctgggacgagagcggctggtggaccgcgcccgagcggatcggcgaccggatc
gcgccgctggtcggggccgctcccggacggatcgtggtcggcgactcgaccagcgtgaac
gtcttcaaggcggtcgtcgccgcgagccgtctcgcccccggcgaccgggacgagatcgtg
ctcgacgcgacgacgttccccagcgacgggtacatcgccgagtcggcggcccggatgacg
ggccaccgcctggtcgtggccgacccgtcggacgtaccggcggcgctcggtccgcgtacc
gcgctcgtcctgctcaaccacgtcgactaccgcacgggcaggctccaggacctgcccggt
ctcaccgccgccgcccacgcggcgggggccctcgccgtgtgggacctgtgccacagcgcg
ggcgccctgcccgtcgggctcgacgcccacggggtggacctcgcggtgggctgcacctac
aagtacctcaacggcggccccggttcaccggccttcctgtacgtcgccgagcgccaccag
gcagccttcgactcaccgctgcccggctggacctcgcacgccgacccgttcgcgatggac
ctgggctacacccccgccgaggggtcggtgcgcggccgggtcggcaccccggacatcctc
tccatgctggcgctggaggcgtcgctcgacgtgtgggacggcgtcaccatggaggccgtg
cgcgccaagtcgctggcgctgacggacttcttcctggagtgcgtcgaggcgtacgtcccc
gagggccgggtcacctccgtcaccccggccgcccacgccgagcgcggcagccaggtctcg
ctccggtgcgagggcgccgccgaggtgatgggcgcgctcatcgcccgcggagtcgtcggc
gacctgcgccgaccggacatcctgcgcttcggcttcaccccgctgtacgtcggcttcgcg
gacgcggagcgggcggcgcgggtcctcgccgaggtgctggaggcgtaa

DBGET integrated database retrieval system