KEGG   Streptomyces sp. SirexAA-E: SACTE_5877Help
Entry
SACTE_5877        CDS       T01601                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEN13662
UniProt: G2NGC1
LinkDB All DBs
Position
6689291..6690304
Genome map
AA seq 337 aa AA seqDB search
MELDADGRAVRLSNPDKVYFPDKGYTKKDVADYFLAVGPGILRALRDRPTTLQRFVDGVE
GEFFYQKRAPKNLPDWTPTARIEFPSGRHADEMCPTELGAVLWAANLGTLTFHPWPVRRA
DTDHPDELRIDLDPQPGTDYADAVRAAHELRSVLDDHGLRGWPKTSGGRGLHVFVPIVPE
WTFTQVRRAAIAAGRELERRMPDRVTTAWWKEERGERIFVDYNQTARDRTIASAYSVRPF
PHAPVSAPLRWDEVDDVEPRDFDIRTMPRRFAEVGDLHADMDEHAFRLDGLLELARRDEH
EHELGDLPYPPEYPKMPGEPKRVQPSRARKEDEGGTA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaactggacgcggacggacgggccgtacggctgtccaacccggacaaggtgtatttc
ccggacaagggctacaccaagaaggacgtggccgactacttcctggccgtggggcccggc
atcctgcgcgccctgcgcgaccggccgaccaccctccagcggttcgtcgacggggtggag
ggcgagttcttctaccagaagcgggcgccgaagaacctccccgactggacgcccacagcc
cgcatcgagttccccagcgggcggcacgccgacgagatgtgccccaccgaactgggcgcc
gtcctgtgggccgccaacctcggtaccctgaccttccacccctggccggtccgccgcgcc
gacaccgaccaccccgacgagctgcgcatcgacctcgacccgcagcccggcaccgactac
gccgacgcggtgcgggccgcccatgaactgcgctccgtcctggacgaccacgggctgcgc
ggctggcccaagacctccggcggccgcggcctccacgtcttcgtcccgatcgtgcccgag
tggaccttcacccaggtccggcgggccgccatcgccgcgggacgcgagctggagcgccgg
atgccggaccgggtgaccaccgcgtggtggaaggaggaacgcggcgagcggatcttcgtg
gactacaaccagacggcccgcgaccgcaccatcgcctccgcctactccgtacgccccttc
ccgcacgcccccgtctccgccccgctgcgctgggacgaggtcgacgacgtggagccccgc
gacttcgacatccggaccatgccccggcggttcgccgaggtgggcgatctgcacgccgac
atggacgagcacgccttccggctcgacggtctgctggagctggcccgccgcgacgagcac
gagcacgagctcggcgacctgccctaccccccggagtaccccaagatgcccggcgaaccc
aagcgggtgcagcccagtcgtgccaggaaagaggacgagggcggcaccgcatga

DBGET integrated database retrieval system